9X3Y: NPFF bound Mas1 Receptor

NPFF bound Mas1 Receptor. Determined by electron microscopy at 2.77 Å resolution. Released 15 Apr 2026.

Method: Electron microscopy
Resolution: 2.77 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,015
Mol. weight: 38.59 kDa
Released: 15 Apr 2026

Explore 9X3Y in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9X3Y contains 14 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain R: 14 helices, 0 β-strands

Element	Residues	Length
α-helix	34-59	26
α-helix	65-92	28
α-helix	102-135	34
α-helix	137-142	6
α-helix	148-166	19
α-helix	167-172	6
α-helix	182-193	12
α-helix	194-199	6
α-helix	200-215	16
α-helix	226-236	11
α-helix	237-241	5
α-helix	242-254	13
α-helix	261-277	17
α-helix	278-282	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Proto-oncogene Mas	R	protein	325	Homo sapiens	P04201 (AlphaFold model)
Npff	L	protein	8	Homo sapiens

Sequence of entity 1 (R), FASTA

>9X3Y_1 Proto-oncogene Mas (chains R)
MDGSNVTSFVVEEPTNISTGRNASVGNAHRQIPIVHWVIMSISPVGFVENGILLWFLCFR
MRRNPFTVYITHLSIADISLLFCIFILSIDYALDYELSSGHYYTIVTLSVTFLFGYNTGL
YLLTAISVERCLSVLYPIWYRCHRPKYQSALVCALLWALSCLVTTMEYVMCIDREEESHS
RNDCRAVIIFIAILSFLVFTPLMLVSSTILVVKIRKNTWASHSSKLYIVIMVTIIIFLIF
AMPMRLLYLLYYEYWSTFGNLHHISLLFSTINSSANPFIYFFVGSSKKKRFKESLKVVLT
RAFKDEMQPRRQKDNCNTVTVETVV

Sequence of entity 2 (L), FASTA

>9X3Y_2 NPFF (chains L)
FLFQPQRF

Primary citation

Structural insight into ligand binding and activation of the orphan GPCR Mas1. Zhang, Y., Wang, Q., Liu, H. et al. EMBO J (2026) 45:3500-3513. DOI 10.1038/s44318-026-00764-6 · PubMed

Other PDB entries of the same protein (UniProt P04201 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9X3Z 2.54 Å, NPFF bound Mas1 Receptor Complex
9JLC 2.98 Å, Cryo-EM structure of MAS1-Gi Complex with AVE 0991
25IK 3.0 Å, Cryo-EM structure of MasR(FL)-Gq
9X40 3.07 Å, AR234958 bound Mas1 Receptor Complex
25IL 3.2 Å, Cryo-EM structure of MasR(del2-25)-Gq
9X41 3.31 Å, AR234958 bound Mas1 Receptor

Browse structure collections

About this viewer

MolViewer shows 9X3Y directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.