9X41: AR234958 bound Mas1 Receptor

AR234958 bound Mas1 Receptor. Determined by electron microscopy at 3.31 Å resolution. Released 20 May 2026.

Method: Electron microscopy
Resolution: 3.31 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,012
Mol. weight: 38.07 kDa
Ligands: A1MCH
Released: 20 May 2026

Explore 9X41 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9X41 contains 13 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain R: 13 helices, 0 β-strands

Element	Residues	Length
α-helix	34-59	26
α-helix	67-91	25
α-helix	96-100	5
α-helix	102-135	34
α-helix	137-142	6
α-helix	148-167	20
α-helix	184-194	11
α-helix	195-199	5
α-helix	200-214	15
α-helix	226-236	11
α-helix	237-241	5
α-helix	243-253	11
α-helix	261-280	20

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Proto-oncogene Mas	R	protein	325	Homo sapiens	P04201 (AlphaFold model)

Sequence of entity 1 (R), FASTA

>9X41_1 Proto-oncogene Mas (chains R)
MDGSNVTSFVVEEPTNISTGRNASVGNAHRQIPIVHWVIMSISPVGFVENGILLWFLCFR
MRRNPFTVYITHLSIADISLLFCIFILSIDYALDYELSSGHYYTIVTLSVTFLFGYNTGL
YLLTAISVERCLSVLYPIWYRCHRPKYQSALVCALLWALSCLVTTMEYVMCIDREEESHS
RNDCRAVIIFIAILSFLVFTPLMLVSSTILVVKIRKNTWASHSSKLYIVIMVTIIIFLIF
AMPMRLLYLLYYEYWSTFGNLHHISLLFSTINSSANPFIYFFVGSSKKKRFKESLKVVLT
RAFKDEMQPRRQKDNCNTVTVETVV

Ligands and cofactors

ID	Name	Formula	Copies
A1MCH	1-(4-fluorophenyl)-4-[[(3~{R},4~{R})-4-(3-fluorophenyl)-1-(2-methoxy-4-nitro-ph…	C28 H30 F2 N4 O5 S	1

Primary citation

Structural insight into ligand binding and activation of the orphan GPCR Mas1. Zhang, Y., Wang, Q., Liu, H. et al. EMBO J (2026) 45:3500-3513. DOI 10.1038/s44318-026-00764-6 · PubMed

Other PDB entries of the same protein (UniProt P04201 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9X3Z 2.54 Å, NPFF bound Mas1 Receptor Complex
9X3Y 2.77 Å, NPFF bound Mas1 Receptor
9JLC 2.98 Å, Cryo-EM structure of MAS1-Gi Complex with AVE 0991
25IK 3.0 Å, Cryo-EM structure of MasR(FL)-Gq
9X40 3.07 Å, AR234958 bound Mas1 Receptor Complex
25IL 3.2 Å, Cryo-EM structure of MasR(del2-25)-Gq

Browse structure collections

About this viewer

MolViewer shows 9X41 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.