9YB9: SFTI-1 containing L-2-Thiaproline at residue 13

SFTI-1 containing L-2-Thiaproline at residue 13 in complex with Trypsin. Determined by X-ray diffraction at 1.13 Å resolution. Released 23 Sept 2026.

Method: X-ray diffraction
Resolution: 1.13 Å
Organisms: Bos taurus, Helianthus annuus
Chains: 2
Atoms: 2,177
Mol. weight: 28.67 kDa
Ligands: CA
Released: 23 Sept 2026

Explore 9YB9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9YB9 contains 7 α-helices and 20 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	25	1	1
β-strand	28-29	2	2
β-strand	38-42	5	3
β-strand	46-54	9	3
β-strand	57-60	4	3
α-helix	62-64	3
β-strand	70-73	4	3
β-strand	86-95	10	3
β-strand	109-113	5	3
β-strand	120	1	4
β-strand	123	1	4
β-strand	127	1	2
α-helix	128-129	2
β-strand	138-143	6	2
β-strand	159-165	7	2
α-helix	166-167	2
α-helix	168-174	7
β-strand	183-186	4	2
β-strand	194	1	1
β-strand	203-206	4	2
β-strand	209-218	10	2
β-strand	227-231	5	2
α-helix	232-235	4
α-helix	236-245	10

Chain B: 1 helix, 2 β-strands

Element	Residues	Length	Sheet
β-strand	2-4	3	2
α-helix	9-10	2
β-strand	11	1	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Pretrypsinogen I,	A	protein	246	Bos taurus	P00760 (AlphaFold model)
Trypsin inhibitor 1	B	protein	14	Helianthus annuus	Q4GWU5 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9YB9_1 Pretrypsinogen I, (chains A)
MKTFIFLALLGAAVAFPVDDDDKIVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVS
AAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLN
SRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQIT
SNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIK
QTIASN

Sequence of entity 2 (B), FASTA

>9YB9_2 Trypsin inhibitor 1 (chains B)
GRCTKSIPPICFXD

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	1

Water and common crystallization additives (SO4, GOL, EDO, ACT) are not listed.

Primary citation

SFTI-1 containing L-2-Thiaproline at residue 13 in complex with Trypsin. Gare, C.L., Frkic, R.L., White, A.M. et al. To be published.

Other PDB entries of the same protein (UniProt P00760 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4I8H 0.75 Å, Bovine trypsin at 0.75 resolution
5MN1 0.79 Å, Cationic trypsin in complex with 2-aminopyridine (deuterated sample at 100 K)
5MNK 0.8 Å, Cationic trypsin in complex with benzylamine (deuterated sample at 100 K)
3MFJ 0.8 Å, Bovine trypsin at 0.8 A resolution, restrained refinement
3MI4 0.8 Å, Bovine trypsin at 0.8 A resolution, non-restrained refinement
4I8G 0.8 Å, Bovine trypsin at 0.8 resolution
4I8K 0.85 Å, Bovine trypsin at 0.85 resolution
5MNN 0.86 Å, Cationic trypsin in complex with N-amidinopiperidine (deuterated sample at 100 K)
5MNG 0.86 Å, Cationic trypsin in complex with benzamidine (deuterated sample at 100 K)
4I8J 0.87 Å, Bovine trypsin at 0.87 A resolution
4I8L 0.87 Å, Bovine trypsin at 0.87 resolution
4XOJ 0.91 Å, Structure of bovine trypsin in complex with analogues of sunflower inhibitor 1 (SFTI-1)

Browse structure collections

About this viewer

MolViewer shows 9YB9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.