9YLB: Ubiquitin-like modifier-activating enzyme 6

Cryo-EM structure of single-loaded human UBA6-UBE2Z/FAT10(a) adenylate complex. Determined by electron microscopy at 3.24 Å resolution. Released 12 Aug 2026.

Method: Electron microscopy
Resolution: 3.24 Å
Organism: Homo sapiens
Chains: 3
Atoms: 10,855
Mol. weight: 163.78 kDa
Ligands: AMP, IHP
Released: 12 Aug 2026

Explore 9YLB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9YLB contains 69 α-helices and 72 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 57 helices, 49 β-strands

Element	Residues	Length	Sheet
α-helix	46-49	4
α-helix	53-59	7
β-strand	63-67	5	1
α-helix	73-83	11
β-strand	87-91	5	1
β-strand	95	1	2
α-helix	96	1
α-helix	99-102	4
α-helix	110-113	4
β-strand	117	1	2
α-helix	118-121	4
α-helix	123-129	7
β-strand	134-138	5	1
β-strand	156-160	5	1
α-helix	164-176	13
α-helix	180-181	2
β-strand	182-189	8	1
β-strand	190	1	3
β-strand	192-198	7	1
β-strand	202-205	4	4
α-helix	213-215	3
β-strand	216-217	2	5
β-strand	218-221	4	6
β-strand	227-231	5	6
β-strand	244-251	8	5
β-strand	257	1	5
β-strand	260-262	3	5
β-strand	267	1	6
β-strand	270-273	4	6
α-helix	280-282	3
β-strand	284-290	7	5
β-strand	295-298	4	4
α-helix	302-305	4
α-helix	311	1
β-strand	312	1	1
α-helix	313	1
α-helix	321-339	19
α-helix	342-344	3
α-helix	348-362	15
α-helix	373-381	9
β-strand	386	1	3
α-helix	388-407	20
α-helix	411-413	3
β-strand	417	1	1
β-strand	420	1	1
α-helix	422-426	5
α-helix	433-435	3
α-helix	447-450	4
α-helix	452-459	8
β-strand	462-466	5	7
α-helix	470-482	13
β-strand	492-496	5	7
α-helix	499	1
β-strand	500	1	8
α-helix	501	1
β-strand	520	1	8
α-helix	521-532	12
β-strand	538-541	4	7
α-helix	547-549	3
α-helix	555-560	6
β-strand	563-566	4	7
α-helix	572-584	13
β-strand	588-594	7	7
β-strand	595	1	9
β-strand	597-603	7	7
β-strand	608	1	10
α-helix	611-613	3
α-helix	616-619	4
α-helix	621-623	3
α-helix	624-628	5
α-helix	634-646	13
α-helix	647-651	5
α-helix	652-662	11
α-helix	670-674	5
α-helix	682-690	9
α-helix	696-708	13
α-helix	709-713	5
α-helix	714-721	8
α-helix	739-742	4
α-helix	752-768	17
α-helix	771-773	3
α-helix	780-787	8
α-helix	858-872	15
α-helix	875-877	3
α-helix	880-888	9
α-helix	890-892	3
β-strand	893	1	9
α-helix	895-913	19
β-strand	922-927	6	7
β-strand	932-937	6	7
β-strand	940	1	10
β-strand	944-946	3	11
β-strand	950-952	3	11
β-strand	958-961	4	12
β-strand	967	1	13
α-helix	968-979	12
β-strand	983-987	5	14
β-strand	992	1	14
α-helix	1002-1004	3
β-strand	1008	1	13
α-helix	1009-1013	5
β-strand	1021-1024	4	12
β-strand	1025-1028	4	14
α-helix	1036-1037	2
β-strand	1038-1039	2	14
β-strand	1043-1046	4	12

Chain B: 8 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	101-113	13
α-helix	115-116	2
β-strand	123	1	15
β-strand	131	1	15
β-strand	134-136	3	16
β-strand	137	1	17
α-helix	138	1
β-strand	144	1	17
β-strand	147-149	3	16
β-strand	150-152	3	15
β-strand	165-167	3	15
β-strand	181	1	18
β-strand	186	1	15
β-strand	187	1	18
α-helix	206-216	11
α-helix	237-250	14
α-helix	265-267	3
α-helix	268-288	21
α-helix	317-323	7

Chain C: 4 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	29	1	19
α-helix	30-38	9
β-strand	50	1	20
β-strand	56	1	20
β-strand	62	1	19
α-helix	63-66	4
β-strand	77	1	20
β-strand	87-93	7	21
β-strand	101-107	7	21
β-strand	111	1	22
α-helix	112-120	9
α-helix	127-129	3
β-strand	132-134	3	21
β-strand	137-138	2	21
β-strand	144	1	22
β-strand	155-158	4	21

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ubiquitin-like modifier-activating enzyme 6	A	protein	1016	Homo sapiens	A0AVT1 (AlphaFold model)
Ubiquitin-conjugating enzyme E2 Z	B	protein	262	Homo sapiens	Q9H832 (AlphaFold model)
Ubiquitin D	C	protein	165	Homo sapiens	A0A1U9X8S9 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9YLB_1 Ubiquitin-like modifier-activating enzyme 6 (chains A)
VEIDDALYSRQRYVLGDTAMQKMAKSHVFLSGMGGLGLEIAKNLVLAGIKAVTIHDTEKC
QAWDLGTNFFLSEDDVVNKRNRAEAVLKHIAELNPYVHVTSSSVPFNETTDLSFLDKYQC
VVLTEMKLPLQKKINDFCRSQCPPIKFISADVHGIWSRLFCDFGDEFEVLDTTGEEPKEI
FISNITQANPGIVTCLENHPHKLETGQFLTFREINGMTGLNGSIQQITVISPFSFSIGDT
TELEPYLHGGIAVQVKTPKTVFFESLERQLKHPKCLIVDFSNPEAPLEIHTAMLALDQFQ
EKYSRKPNVGCQQDSEELLKLATSISETLEEKPDVNADIVHWLSWTAQGFLSPLAAAVGG
VASQEVLKAVTGKFSPLCQWLYLEAADIVESLGKPECEEFLPRGDRYDALRACIGDTLCQ
KLQNLNIFLVGCGAIGCEMLKNFALLGVGTSKEKGMITVTDPDLIEKSNLNRQFLFRPHH
IQKPKSYTAADATLKINSQIKIDAHLNKVCPTTETIYNDEFYTKQDVIITALDNVEARRY
VDSRCLANLRPLLDSGTMGTKGHTEVIVPHLTESYNSHRDPPEEEIPFCTLKSFPAAIEH
TIQWARDKFESSFSHKPSLFNKFWQTYSSAEEVLQKIQSGHSLEGCFQVIKLLSRRPRNW
SQCVELARLKFEKYFNHKALQLLHCFPLDIRLKDGSLFWQSPKRPPSPIKFDLNEPLHLS
FLQNAAKLYATVYCIPFAEEDLSADALLNILSEVKIQEFKPSNKVVQTDETARKPDHVPI
SSEDERNAIFQLEKAILSNEATKSDLQMAVLSFEKDDDHNGHIDFITAASNLRAKMYSIE
PADRFKTKRIAGKIIPAIATTTATVSGLVALEMIKVTGGYPFEAYKNCFLNLAIPIVVFT
ETTEVRKTKIRNGISFTIWDRWTVHGKEDFTLLDFINAVKEKYGIEPTMVVQGVKMLYVP
VMPGHAKRLKLTMHKLVKPTTEKKYVDLTVSFAPDIDGDEDLPGPPVRYYFSHDTD

Sequence of entity 2 (B), FASTA

>9YLB_2 Ubiquitin-conjugating enzyme E2 Z (chains B)
GERTAPQSLLRIKRDIMSIYKEPPPGMFVVPDTVDMTKIHALITGPFDTPYEGGFFLFVF
RCPPDYPIHPPRVKLMTTGNNTVRFNPNFARNGKVCLSILGTWTGPAWSPAQSISSVLIS
IQSLMTENPYHNEPGFEQERHPGDSKNYNECIRHETIRVAVCDMMEGKSPSPEPLRGVME
KSFLEYYDFYEVACKDRLHLQGQTMQDPFGEKRGHFDYQSLLMRLGLIRQKVLERLHNEN
AEMDSDSSSSGTETDLHGSLRV

Sequence of entity 3 (C), FASTA

>9YLB_3 Ubiquitin D (chains C)
MAPNASTLTVHVRSEEWDLMTFDANPYDSVKKIKEHVRSKTKVPVQDQVLLLGSKILKPR
RSLSSYGIDKEKTIHLTLKVVKPSDEELPLFLVESGDEAKRHLLQVRRSSSVAQVKAMIE
TKTGIIPETQIVTLNGKRLEDGKMMADYGIRKGNLLFLASYSIGG

Ligands and cofactors

ID	Name	Formula	Copies
AMP	Adenosine monophosphate	C10 H14 N5 O7 P	1
IHP	Inositol hexakisphosphate	C6 H18 O24 P6	1

Primary citation

Cryo-EM structures of UBA6 reveal mechanisms of E1-E2 specificity and dual FAT10/ubiquitin thioester transfer. Nayak, D., Jia, L., Dos Santos Bury, P. et al. Nat Commun (2026) 17. DOI 10.1038/s41467-026-69882-3 · PubMed

Other PDB entries of the same protein (UniProt A0AVT1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7SOL 2.25 Å, Crystal Structures of the bispecific ubiquitin/FAT10 activating enzyme, Uba6
7PVN 2.71 Å, Crystal Structure of Human UBA6 in Complex with ATP
9YKV 2.73 Å, Cryo-EM structure of double-loaded human UBA6-UBE2Z-FAT10(t)/FAT10(a) thioester mimetic…
28MJ 2.77 Å, Cryo-EM structure of UBA6 in complex with FAT10 in the pre-adenylation state.
28MO 3.01 Å, Cryo-EM structure of UBA6-UbDha-UBE2Z trapped ternary complex (singly loaded)
28MQ 3.04 Å, Cryo-EM structure of UBA6-FAT10Dha-UBE2Z trapped ternary complex
9QH5 3.09 Å, Consensus structure of UBA6-UbDha-BIRC6 trapped ternary complex (doubly loaded)
28MP 3.12 Å, Cryo-EM structure of UBA6-UbDha-UBE2Z trapped ternary complex (doubly loaded)
9YLF 3.14 Å, Cryo-EM structure of single-loaded human UBA6-UBE2Z/Ub(a) adenylate complex.
7PYV 3.27 Å, Crystal structure of human UBA6 in complex with the ubiquitin-like modifier FAT10
9QIC 3.29 Å, Consensus structure of UBA6
9XGB 3.3 Å, UBA6-BIRC6 ubc-ubt

Browse structure collections

About this viewer

MolViewer shows 9YLB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.