9YMU: DNA-directed RNA polymerase subunit beta

De novo initial transcribing RNA polymerase with 2-mer RNA and bound CTP / Michaelis complex (RPitc2+CTP). Determined by electron microscopy at 2.7 Å resolution. Released 29 Apr 2026.

Method: Electron microscopy
Resolution: 2.7 Å
Organisms: Escherichia coli, Escherichia phage T7
Chains: 9
Atoms: 32,296
Mol. weight: 522.33 kDa
Ligands: MG, ZN, CTP
Released: 29 Apr 2026

Explore 9YMU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9YMU contains 177 α-helices and 213 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain G: 8 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	9-11	3
β-strand	12-18	7	60
β-strand	23-31	9	60
α-helix	35-47	13
β-strand	52-61	10	61
β-strand	74	1	62
α-helix	78-85	8
β-strand	90-92	3	63
β-strand	97-105	9	61
β-strand	108-111	4	62
α-helix	112-114	3
β-strand	115	1	61
α-helix	116-117	2
β-strand	121-123	3	63
β-strand	129-133	5	62
β-strand	139-150	12	61
β-strand	152-153	2	64
α-helix	155-157	3
β-strand	170-172	3	61
β-strand	175-176	2	64
β-strand	180-189	10	60
β-strand	199-207	9	60
α-helix	213-227	15
α-helix	229-232	4

Chain H: 5 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	13-18	6	65
β-strand	23-31	9	65
α-helix	35-49	15
β-strand	52-60	9	66
β-strand	61	1	67
β-strand	64	1	67
α-helix	78-86	9
β-strand	90-92	3	68
β-strand	97-105	9	66
β-strand	108-111	4	69
α-helix	112-114	3
β-strand	115	1	66
α-helix	116-117	2
β-strand	121-123	3	68
β-strand	129-133	5	69
β-strand	139-150	12	66
β-strand	152-153	2	70
β-strand	170-172	3	66
β-strand	175-176	2	70
β-strand	180-192	13	65
β-strand	195-207	13	65
α-helix	213-226	14

Chain I: 58 helices, 96 β-strands

Element	Residues	Length	Sheet
α-helix	5-8	4
α-helix	11-12	2
β-strand	13-14	2	1
α-helix	29-39	11
α-helix	49-56	8
α-helix	57-58	2
β-strand	59-60	2	2
β-strand	66-75	10	2
α-helix	82-88	7
β-strand	93-105	13	2
β-strand	114-128	15	2
β-strand	130	1	3
β-strand	136-138	3	3
β-strand	141-145	5	3
β-strand	147-151	5	4
α-helix	152	1
β-strand	154-158	5	5
β-strand	173-177	5	5
β-strand	180	1	6
β-strand	184-187	4	5
β-strand	195-198	4	5
β-strand	204-205	2	5
α-helix	207-212	6
α-helix	217-224	8
β-strand	227-233	7	7
β-strand	236-240	5	7
α-helix	243-246	4
β-strand	250	1	8
β-strand	255-257	3	9
β-strand	260-263	4	9
β-strand	268	1	8
α-helix	271-280	10
β-strand	284-287	4	7
α-helix	289-292	4
β-strand	296	1	10
β-strand	297	1	7
β-strand	301-303	3	11
β-strand	308-311	4	11
β-strand	316	1	10
α-helix	319-326	8
β-strand	332-336	5	7
α-helix	346-353	8
α-helix	359-370	12
α-helix	378-389	12
β-strand	396	1	6
α-helix	398-408	11
α-helix	422-437	16
α-helix	442-444	3
β-strand	451-454	4	4
α-helix	456-480	25
α-helix	489-492	4
α-helix	496-508	13
β-strand	512-514	3	3
α-helix	515-516	2
α-helix	520-527	8
β-strand	529-531	3	4
α-helix	540-542	3
α-helix	552-554	3
β-strand	558	1	12
β-strand	572-574	3	4
β-strand	575	1	12
β-strand	576	1	13
β-strand	580-581	2	14
β-strand	587-595	9	14
β-strand	598-607	10	14
α-helix	608-611	4
β-strand	616-617	2	14
β-strand	623	1	15
β-strand	629	1	15
β-strand	633-637	5	14
β-strand	642-646	5	14
β-strand	652-653	2	14
β-strand	662	1	13
α-helix	665-667	3
α-helix	671-673	3
β-strand	674	1	16
α-helix	676-686	11
β-strand	689	1	17
α-helix	690-691	2
β-strand	700-701	2	1
α-helix	705-712	8
β-strand	716-717	2	18
β-strand	722-727	6	19
β-strand	731-736	6	19
β-strand	748-752	5	19
β-strand	757-758	2	20
β-strand	764-765	2	20
β-strand	768-769	2	18
β-strand	776-777	2	19
β-strand	782-785	4	18
β-strand	789-790	2	21
β-strand	793-794	2	21
β-strand	798-804	7	22
β-strand	815-819	5	22
α-helix	820-824	5
β-strand	830-841	12	23
β-strand	842	1	24
β-strand	847	1	24
β-strand	849	1	25
α-helix	860-862	3
β-strand	865	1	26
β-strand	870	1	27
β-strand	871	1	26
α-helix	872	1
β-strand	876-877	2	23
β-strand	882-884	3	27
β-strand	887-889	3	25
α-helix	897-906	10
α-helix	909-911	3
β-strand	913-915	3	25
β-strand	918-919	2	27
α-helix	920-921	2
β-strand	926-935	10	23
α-helix	943-980	38
α-helix	988-991	4
α-helix	994-998	5
α-helix	1006-1009	4
α-helix	1011-1037	27
α-helix	1042-1043	2
β-strand	1046-1058	13	23
β-strand	1065-1067	3	22
β-strand	1073-1080	8	22
α-helix	1082-1084	3
β-strand	1087	1	28
β-strand	1093	1	28
β-strand	1096-1098	3	22
α-helix	1102-1106	5
β-strand	1108	1	16
α-helix	1110-1133	24
α-helix	1138-1150	13
α-helix	1161-1163	3
α-helix	1168-1176	9
β-strand	1182-1183	2	1
α-helix	1192-1201	10
β-strand	1209-1210	2	22
β-strand	1213	1	28
α-helix	1219	1
β-strand	1220	1	28
α-helix	1221	1
β-strand	1225-1234	10	22
β-strand	1235	1	17
α-helix	1239-1241	3
β-strand	1244-1246	3	29
β-strand	1251	1	30
β-strand	1252	1	31
β-strand	1258	1	30
β-strand	1260	1	32
β-strand	1267	1	32
β-strand	1268-1270	3	33
α-helix	1272-1280	9
α-helix	1284-1291	8
α-helix	1298-1309	12
α-helix	1321-1332	12
β-strand	1335-1340	6	34

Chain J: 72 helices, 80 β-strands

Element	Residues	Length	Sheet
β-strand	19-24	6	34
α-helix	27-33	7
β-strand	34-37	4	35
β-strand	44	1	36
α-helix	50	1
β-strand	51	1	36
α-helix	52	1
α-helix	59-62	4
α-helix	78-80	3
β-strand	84	1	37
β-strand	91	1	37
α-helix	95-99	5
β-strand	102-112	11	35
α-helix	115-118	4
α-helix	122	1
α-helix	123-128	6
α-helix	132-139	8
β-strand	144-148	5	38
α-helix	154-155	2
β-strand	159-160	2	38
α-helix	162-172	11
β-strand	177-179	3	38
α-helix	181-190	10
α-helix	194-206	13
α-helix	211-229	19
α-helix	234-237	4
β-strand	238-244	7	35
α-helix	247-249	3
β-strand	252-254	3	39
β-strand	260-262	3	39
α-helix	265-285	21
α-helix	289-307	19
α-helix	315-316	2
β-strand	317	1	40
β-strand	323	1	40
α-helix	324-325	2
α-helix	327-331	5
α-helix	337	1
α-helix	338-342	5
β-strand	345-347	3	33
β-strand	350-354	5	29
β-strand	355-357	3	41
β-strand	365-369	5	41
α-helix	370-376	7
α-helix	378-388	11
α-helix	394-403	10
α-helix	406-415	10
β-strand	421-424	4	29
α-helix	431-433	3
β-strand	434-437	4	29
β-strand	438-442	5	41
β-strand	447-449	3	41
α-helix	454-457	4
β-strand	465-469	5	29
α-helix	474-482	9
β-strand	485	1	29
α-helix	486-488	3
β-strand	491	1	42
β-strand	498	1	42
α-helix	505-513	9
β-strand	526-527	2	43
α-helix	530-538	9
β-strand	547-557	11	43
β-strand	563-573	11	43
α-helix	574-579	6
α-helix	580-582	3
α-helix	584	1
α-helix	589-591	3
α-helix	598-611	14
α-helix	614-635	22
α-helix	645-647	3
α-helix	649-669	21
α-helix	675-701	27
β-strand	703-707	5	44
β-strand	713-717	5	44
α-helix	721-728	8
α-helix	734-741	8
β-strand	745-748	4	45
α-helix	753	1
β-strand	754-759	6	45
α-helix	769-788	20
α-helix	790-804	15
β-strand	809-811	3	46
β-strand	820-822	3	47
β-strand	825-827	3	48
β-strand	828	1	49
β-strand	830-833	4	48
α-helix	835-839	5
β-strand	843	1	50
β-strand	844	1	47
β-strand	848-849	2	51
β-strand	856-858	3	51
β-strand	863	1	50
α-helix	866-874	9
β-strand	880-882	3	47
β-strand	894-895	2	46
α-helix	896-899	4
β-strand	901	1	52
β-strand	908	1	52
α-helix	909-910	2
α-helix	915-931	17
β-strand	940	1	45
α-helix	945-947	3
β-strand	949-952	4	53
β-strand	956-961	6	49
β-strand	965-967	3	53
β-strand	973-975	3	53
β-strand	980-985	6	49
β-strand	991-997	7	49
β-strand	1002-1003	2	53
β-strand	1010-1011	2	49
β-strand	1015-1019	5	53
β-strand	1024-1028	5	54
β-strand	1033-1038	6	55
β-strand	1046-1050	5	54
β-strand	1057-1061	5	54
α-helix	1062	1
α-helix	1070-1072	3
β-strand	1077-1081	5	55
β-strand	1087	1	55
α-helix	1088	1
β-strand	1089	1	56
α-helix	1090	1
β-strand	1096	1	56
β-strand	1100	1	55
β-strand	1106-1107	2	54
β-strand	1114-1115	2	55
β-strand	1120-1125	6	54
α-helix	1134-1145	12
α-helix	1153-1154	2
β-strand	1155-1156	2	57
β-strand	1161-1165	5	58
β-strand	1172-1178	7	58
β-strand	1186-1191	6	58
α-helix	1195-1196	2
β-strand	1203-1204	2	58
β-strand	1209-1211	3	57
α-helix	1214-1216	3
α-helix	1217-1223	7
α-helix	1226-1243	18
α-helix	1250-1259	10
β-strand	1263-1268	6	59
β-strand	1279-1281	3	59
α-helix	1282-1294	13
β-strand	1301-1305	5	59
α-helix	1309-1314	6
α-helix	1319-1325	7
α-helix	1328-1338	11
β-strand	1341-1342	2	34
α-helix	1347-1352	6
α-helix	1360-1362	3
α-helix	1363-1374	12

Chain K: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	7-13	7
α-helix	16-31	16
α-helix	35-37	3
α-helix	46-56	11
α-helix	61-77	17

Chain L: 29 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	97-105	9
α-helix	113-133	21
α-helix	138-152	15
α-helix	215-233	19
α-helix	245-258	14
α-helix	263-295	33
α-helix	299-306	8
α-helix	314-319	6
α-helix	325-329	5
α-helix	330-332	3
α-helix	334-351	18
α-helix	355-382	28
α-helix	384-392	9
α-helix	401-417	17
α-helix	421-423	3
α-helix	427-446	20
α-helix	454-474	21
α-helix	477-479	3
α-helix	480-487	8
α-helix	491-497	7
α-helix	503-504	2
β-strand	505-506	2	39
β-strand	510	1	71
β-strand	518	1	71
α-helix	519-522	4
α-helix	523	1
β-strand	524	1	31
α-helix	525	1
α-helix	531-548	18
α-helix	553-563	11
α-helix	573-579	7
α-helix	584-598	15
α-helix	605-610	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA-directed RNA polymerase subunit beta	I	protein	1342	Escherichia coli	P0A8V2 (AlphaFold model)
DNA-directed RNA polymerase subunit beta'	J	protein	1415	Escherichia coli	P0A8T7 (AlphaFold model)
DNA-directed RNA polymerase subunit omega	K	protein	91	Escherichia coli	P0A800 (AlphaFold model)
T7A1 promoter fragment non-template strand	P	DNA	97	Escherichia phage T7
Nascent RNA	R	RNA	2	Escherichia coli
DNA-directed RNA polymerase subunit alpha	G, H	protein	329	Escherichia coli	P0A7Z4 (AlphaFold model)
RNA polymerase sigma factor RpoD	L	protein	616	Escherichia coli	P00579
T7A1 promoter fragment template strand	Q	DNA	97	Escherichia phage T7

Sequence of entity 1 (I), FASTA

>9YMU_1 DNA-directed RNA polymerase subunit beta (chains I)
MVYSYTEKKRIRKDFGKRPQVLDVPYLLSIQLDSFQKFIEQDPEGQYGLEAAFRSVFPIQ
SYSGNSELQYVSYRLGEPVFDVQECQIRGVTYSAPLRVKLRLVIYEREAPEGTVKDIKEQ
EVYMGEIPLMTDNGTFVINGTERVIVSQLHRSPGVFFDSDKGKTHSSGKVLYNARIIPYR
GSWLDFEFDPKDNLFVRIDRRRKLPATIILRALNYTTEQILDLFFEKVIFEIRDNKLQME
LVPERLRGETASFDIEANGKVYVEKGRRITARHIRQLEKDDVKLIEVPVEYIAGKVVAKD
YIDESTGELICAANMELSLDLLAKLSQSGHKRIETLFTNDLDHGPYISETLRVDPTNDRL
SALVEIYRMMRPGEPPTREAAESLFENLFFSEDRYDLSAVGRMKFNRSLLREEIEGSGIL
SKDDIIDVMKKLIDIRNGKGEVDDIDHLGNRRIRSVGEMAENQFRVGLVRVERAVKERLS
LGDLDTLMPQDMINAKPISAAVKEFFGSSQLSQFMDQNNPLSEITHKRRISALGPGGLTR
ERAGFEVRDVHPTHYGRVCPIETPEGPNIGLINSLSVYAQTNEYGFLETPYRKVTDGVVT
DEIHYLSAIEEGNYVIAQANSNLDEEGHFVEDLVTCRSKGESSLFSRDQVDYMDVSTQQV
VSVGASLIPFLEHDDANRALMGANMQRQAVPTLRADKPLVGTGMERAVAVDSGVTAVAKR
GGVVQYVDASRIVIKVNEDEMYPGEAGIDIYNLTKYTRSNQNTCINQMPCVSLGEPVERG
DVLADGPSTDLGELALGQNMRVAFMPWNGYNFEDSILVSERVVQEDRFTTIHIQELACVS
RDTKLGPEEITADIPNVGEAALSKLDESGIVYIGAEVTGGDILVGKVTPKGETQLTPEEK
LLRAIFGEKASDVKDSSLRVPNGVSGTVIDVQVFTRDGVEKDKRALEIEEMQLKQAKKDL
SEELQILEAGLFSRIRAVLVAGGVEAEKLDKLPRDRWLELGLTDEEKQNQLEQLAEQYDE
LKHEFEKKLEAKRRKITQGDDLAPGVLKIVKVYLAVKRRIQPGDKMAGRHGNKGVISKIN
PIEDMPYDENGTPVDIVLNPLGVPSRMNIGQILETHLGMAAKGIGDKINAMLKQQQEVAK
LREFIQRAYDLGADVRQKVDLSTFSDEEVMRLAENLRKGMPIATPVFDGAKEAEIKELLK
LGDLPTSGQIRLYDGRTGEQFERPVTVGYMYMLKLNHLVDDKMHARSTGSYSLVTQQPLG
GKAQFGGQRFGEMEVWALEAYGAAYTLQEMLTVKSDDVNGRTKMYKNIVDGNHQMEPGMP
ESFNVLLKEIRSLGINIELEDE

Sequence of entity 2 (J), FASTA

>9YMU_2 DNA-directed RNA polymerase subunit beta' (chains J)
MKDLLKFLKAQTKTEEFDAIKIALASPDMIRSWSFGEVKKPETINYRTFKPERDGLFCAR
IFGPVKDYECLCGKYKRLKHRGVICEKCGVEVTQTKVRRERMGHIELASPTAHIWFLKSL
PSRIGLLLDMPLRDIERVLYFESYVVIEGGMTNLERQQILTEEQYLDALEEFGDEFDAKM
GAEAIQALLKSMDLEQECEQLREELNETNSETKRKKLTKRIKLLEAFVQSGNKPEWMILT
VLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRNNRLKRLLDLAAPDIIVRNEKRMLQ
EAVDALLDNGRRGRAITGSNKRPLKSLADMIKGKQGRFRQNLLGKRVDYSGRSVITVGPY
LRLHQCGLPKKMALELFKPFIYGKLELRGLATTIKAAKKMVEREEAVVWDILDEVIREHP
VLLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCAAYNADFDGDQMAVHVPLTLEAQLEA
RALMMSTNNILSPANGEPIIVPSQDVVLGLYYMTRDCVNAKGEGMVLTGPKEAERLYRSG
LASLHARVKVRITEYEKDANGELVAKTSLKDTTVGRAILWMIVPKGLPYSIVNQALGKKA
ISKMLNTCYRILGLKPTVIFADQIMYTGFAYAARSGASVGIDDMVIPEKKHEIISEAEAE
VAEIQEQFQSGLVTAGERYNKVIDIWAAANDRVSKAMMDNLQTETVINRDGQEEKQVSFN
SIYMMADSGARGSAAQIRQLAGMRGLMAKPDGSIIETPITANFREGLNVLQYFISTHGAR
KGLADTALKTANSGYLTRRLVDVAQDLVVTEDDCGTHEGIMMTPVIEGGDVKEPLRDRVL
GRVTAEDVLKPGTADILVPRNTLLHEQWCDLLEENSVDAVKVRSVVSCDTDFGVCAHCYG
RDLARGHIINKGEAIGVIAAQSIGEPGTQLTMRTFHIGGAASRAAAESSIQVKNKGSIKL
SNVKSVVNSSGKLVITSRNTELKLIDEFGRTKESYKVPYGAVLAKGDGEQVAGGETVANW
DPHTMPVITEVSGFVRFTDMIDGQTITRQTDELTGLSSLVVLDSAERTAGGKDLRPALKI
VDAQGNDVLIPGTDMPAQYFLPGKAIVQLEDGVQISSGDTLARIPQESGGTKDITGGLPR
VADLFEARRPKEPAILAEISGIVSFGKETKGKRRLVITPVDGSDPYEEMIPKWRQLNVFE
GERVERGDVISDGPEAPHDILRLRGVHAVTRYIVNEVQDVYRLQGVKINDKHIEVIVRQM
LRKATIVNAGSSDFLEGEQVEYSRVKIANRELEANGKVGATYSRDLLGITKASLATESFI
SAASFQETTRVLTEAAVAGKRDELRGLKENVIVGRLIPAGTGYAYHQDRMRRRAAGEAPA
APQVTAEDASASLAELLNAGLGGSDNELELEVLFQ

Sequence of entity 3 (K), FASTA

>9YMU_3 DNA-directed RNA polymerase subunit omega (chains K)
MARVTVQDAVEKIGNRFDLVLVAARRARQMQVGGKDPLVPEENDKTTVIALREIEEGLIN
NQILDVRERQEQQEQEAAELQAVTAIAEGRR

Sequence of entity 4 (P), FASTA

>9YMU_4 T7A1 promoter fragment non-template strand (chains P)
GCTTAATTTAAAATTTATCAAAAAGAGTATTGACTTAAAGTCTAACCTATAGGATACTTA
CAGCCATCGAGAGGGACACGGCGAATAGCCATCCCGG

Sequence of entity 5 (R), FASTA

>9YMU_5 Nascent RNA (chains R)
AU

Sequence of entity 6 (G, H), FASTA

>9YMU_6 DNA-directed RNA polymerase subunit alpha (chains G, H)
MQGSVTEFLKPRLVDIEQVSSTHAKVTLEPLERGFGHTLGNALRRILLSSMPGCAVTEVE
IDGVLHEYSTKEGVQEDILEILLNLKGLAVRVQGKDEVILTLNKSGIGPVTAADITHDGD
VEIVKPQHVICHLTDENASISMRIKVQRGRGYVPASTRIHSEEDERPIGRLLVDACYSPV
ERIAYNVEAARVEQRTDLDKLVIEMETNGTIDPEEAIRRAATILAEQLEAFVDLRDVRQP
EVKEEKPEFDPILLRPVDDLELTVRSANCLKAEAIHYIGDLVQRTEVELLKTPNLGKKSL
TEIKDVLASRGLSLGMRLENWPPASIADE

Sequence of entity 7 (L), FASTA

>9YMU_7 RNA polymerase sigma factor RpoD (chains L)
SEFMEQNPQSQLKLLVTRGKEQGYLTYAEVNDHLPEDIVDSDQIEDIIQMINDMGIQVME
EAPDADDLMLAENTADEDAAEAAAQVLSSVESEIGRTTDPVRMYMREMGTVELLTREGEI
DIAKRIEDGINQVQCSVAEYPEAITYLLEQYDRVEAEEARLSDLITGFVDPNAEEDLAPT
ATHVGSELSQEDLDDDEDEDEEDGDDDSADDDNSIDPELAREKFAELRAQYVVTRDTIKA
KGRSHATAQEEILKLSEVFKQFRLVPKQFDYLVNSMRVMMDRVRTQERLIMKLCVEQCKM
PKKNFITLFTGNETSDTWFNAAIAMNKPWSEKLHDVSEEVHRALQKLQQIEEETGLTIEQ
VKDINRRMSIGEAKARRAKKEMVEANLRLVISIAKKYTNRGLQFLDLIQEGNIGLMKAVD
KFEYRRGYKFSTYATWWIRQAITRSIADQARTIRIPVHMIETINKLNRISRQMLQEMGRE
PTPEELAERMLMPEDKIRKVLKIAKEPISMETPIGDDEDSHLGDFIEDTTLELPLDSATT
ESLRAATHDVLAGLTAREAKVLRMRFGIDMNTDYTLEEVGKQFDVTRERIRQIEAKALRK
LRHPSRSEVLRSFLDD

Sequence of entity 8 (Q), FASTA

>9YMU_8 T7A1 promoter fragment template strand (chains Q)
CCGGGATGGCTATTCGCCGTGTCCCTCTCGATGGCTGTAAGTATCCTATAGGTTAGACTT
TAAGTCAATACTCTTTTTGATAAATTTTAAATTAAGC

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	2
ZN	Zinc ion	Zn	2
CTP	Cytidine-5'-triphosphate	C9 H16 N3 O14 P3	1

Primary citation

Structural basis for multi-subunit DNA-dependent RNA polymerase catalytic activity. Mueller, A.U., Darst, S.A. Mol Cell (2026) 86:1881. DOI 10.1016/j.molcel.2026.03.033 · PubMed

Other PDB entries of the same protein (UniProt P0A8V2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3LTI 1.6 Å, Crystal structure of the Escherichia coli RNA polymerase beta subunit beta2-betai4 domains
7EGS 1.7 Å, The crystal structure of lobe domain of E. coli RNA polymerase complexed with the…
8FVW 2.1 Å, CryoEM structure of E.coli transcription elongation complex bound to ppGpp
8FVR 2.42 Å, CryoEM structure of E.coli transcription elongation complex
9ZP4 2.42 Å, E. coli RNA polymerase elongation complex containing the unnatural dZ:PTP base pair in a…
8HKC 2.49 Å, Cryo-EM structure of E. coli RNAP sigma32 complex
6XL5 2.5 Å, Cryo-EM structure of EcmrR-RNAP-promoter open complex (EcmrR-RPo)
6XL9 2.5 Å, Cryo-EM structure of EcmrR-RNAP-promoter initial transcribing complex with 3-nt RNA…
12EC 2.6 Å, Half-translocated RNA polymerase elemental paused elongation complex, swiveled (ePEC…
8F1J 2.6 Å, SigN RNA polymerase early-melted intermediate bound to mismatch DNA fragment dhsU36mm2…
8PIB 2.6 Å, autoinhibited RfaH bound to E. coli transcription complex paused at ops site (encounter…
9MSF 2.6 Å, de novo SigN RNA polymerase transcription initiation intermediate with post-catalytic…

Browse structure collections

About this viewer

MolViewer shows 9YMU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.