9ZKG: VRK1

VRK1 in complex with the inhibitor MP-60. Determined by X-ray diffraction at 2.06 Å resolution. Released 29 Apr 2026.

Method: X-ray diffraction
Resolution: 2.06 Å
Organism: Homo sapiens
Chains: 4
Atoms: 10,738
Mol. weight: 167.53 kDa
Ligands: ACN, GG0, A1C2O
Released: 29 Apr 2026

Explore 9ZKG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9ZKG contains 69 α-helices and 50 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 17 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	28-30	3	1
β-strand	36-42	7	1
β-strand	51-56	6	1
α-helix	61-62	2
β-strand	68-74	7	1
α-helix	78-90	13
α-helix	93-102	10
α-helix	111-112	2
β-strand	113-121	9	1
β-strand	124-132	9	1
β-strand	134-137	4	2
α-helix	138-144	7
α-helix	151-170	20
β-strand	173-174	2	3
α-helix	180-182	3
β-strand	183-186	4	2
β-strand	189-195	7	2
β-strand	202-203	2	3
α-helix	206-208	3
α-helix	210-212	3
α-helix	230-233	4
α-helix	240-256	17
α-helix	262-264	3
α-helix	268-280	13
α-helix	282-289	8
α-helix	297-307	11
α-helix	313-315	3
α-helix	317-330	14

Chain B: 16 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	28-30	3	4
β-strand	36-42	7	4
β-strand	50-56	7	4
α-helix	61-62	2
β-strand	68-74	7	4
α-helix	78-90	13
α-helix	93-102	10
α-helix	111-112	2
β-strand	113-121	9	4
β-strand	124-132	9	4
β-strand	134-137	4	5
α-helix	138-144	7
α-helix	151-170	20
β-strand	174	1	6
α-helix	180-182	3
β-strand	183-186	4	5
β-strand	189-195	7	5
β-strand	202	1	6
α-helix	206-208	3
α-helix	210-212	3
α-helix	230-233	4
α-helix	240-256	17
α-helix	268-280	13
α-helix	282-289	8
α-helix	297-307	11
α-helix	313-315	3
α-helix	317-330	14

Chain C: 18 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	28-30	3	7
β-strand	36-42	7	7
β-strand	50-56	7	7
β-strand	68-74	7	7
α-helix	78-90	13
α-helix	93-102	10
α-helix	110-112	3
β-strand	113-118	6	7
β-strand	121	1	8
β-strand	124	1	8
β-strand	126-132	7	7
β-strand	134-137	4	9
α-helix	138-144	7
α-helix	151-170	20
β-strand	174	1	10
α-helix	180-182	3
β-strand	183-186	4	9
β-strand	193-195	3	9
β-strand	202	1	10
α-helix	206-208	3
α-helix	210-213	4
β-strand	215	1	11
α-helix	217-219	3
α-helix	230-233	4
β-strand	236	1	11
α-helix	237-238	2
α-helix	240-256	17
α-helix	262-264	3
α-helix	268-280	13
α-helix	282-289	8
α-helix	297-308	12
α-helix	313-315	3
α-helix	317-330	14

Chain D: 18 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	28-30	3	12
β-strand	36-42	7	12
β-strand	50-56	7	12
α-helix	61-62	2
β-strand	68-74	7	12
α-helix	79-90	12
α-helix	93-102	10
α-helix	111-112	2
β-strand	113-120	8	12
β-strand	125-132	8	12
β-strand	134-137	4	13
α-helix	138-144	7
α-helix	151-170	20
β-strand	173-174	2	14
α-helix	180-182	3
β-strand	183-186	4	13
β-strand	189-195	7	13
β-strand	202-203	2	14
α-helix	206-208	3
α-helix	209-213	5
β-strand	215	1	15
α-helix	217-219	3
α-helix	230-233	4
β-strand	236	1	15
α-helix	237-238	2
α-helix	240-256	17
α-helix	268-280	13
α-helix	282-289	8
α-helix	297-307	11
α-helix	313-315	3
α-helix	317-330	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Serine/threonine-protein kinase VRK1	A, B, C, D	protein	364	Homo sapiens	Q99986 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>9ZKG_1 Serine/threonine-protein kinase VRK1 (chains A, B, C, D)
SMRVKAAQAGRQSSAKRHLAEQFAVGEIITDMAAAAWKVGLPIGQGGFGCIYLADMNSSE
SVGSDAPCVVKVEPSDNGPLFTELKFYQRAAKPEQIQKWIRTRKLKYLGVPKYWGSGLHD
KNGKSYRFMIMDRFGSDLQKIYEANAKRFSRKTVLQLSLRILDILEYIHEHEYVHGDIKA
SNLLLNYKNPDQVYLVDYGLAYRYCPEGVHKAYAADPKRCHDGTIEFTSIDAHNGVAPSR
RGDLEILGYCMIQWLTGHLPWEDNLKDPKYVRDSKIRYRENIASLMDKCFPAANAPGEIA
KYMETVKLLDYTEKPLYENLRDILLQGLKAIGSKDDGKLDLSVVENGGLKAKTITKKRAA
EIEE

Ligands and cofactors

ID	Name	Formula	Copies
ACN	Acetone	C3 H6 O	1
GG0	2-(2-azanylethanoylamino)ethanoic acid	C4 H8 N2 O3	2
A1C2O	(5Z)-3-butyl-5-[(3,5-dichloro-4-hydroxyphenyl)methylidene]-1,3-thiazolidine-2,4…	C14 H13 Cl2 N O3 S	2

Water and common crystallization additives (GOL, EDO, CL, PEG, SO4) are not listed.

Primary citation

Structure-based discovery of selective vaccinia-related kinase 1 inhibitors and fluorogenic active-site probes. Crowley-Dolen, E.K., Borges, R.J., Charifson, P.S. et al. J Biol Chem (2026) 302:111355-111355. DOI 10.1016/j.jbc.2026.111355 · PubMed

Other PDB entries of the same protein (UniProt Q99986 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7M10 1.15 Å, PHF2 PHD Domain Complexed with Peptide From N-terminus of VRK1
6BRU 1.8 Å, Crystal Structure of the Human vaccinia-related kinase bound to a…
6BU6 1.8 Å, Crystal Structure of the Human vaccinia-related kinase bound to a…
6BP0 1.9 Å, Crystal Structure of the Human vaccinia-related kinase 1 bound to…
6BTW 1.9 Å, Crystal Structure of the Human vaccinia-related kinase bound to a phenyl-pteridinone…
5UVF 2.0 Å, Crystal Structure of the Human vaccinia-related kinase bound to BI-D1870
6CNX 2.0 Å, Crystal Structure of the Human vaccinia-related kinase 1 (VRK1) bound to an…
6VXU 2.0 Å, Structure of Human Vaccinia-related Kinase 1 (VRK1) bound to ACH471
6AC9 2.07 Å, Crystal structure of human Vaccinia-related kinase 1 (VRK1) in complex with AMP-PNP
6CMM 2.1 Å, Crystal Structure of the Human vaccinia-related kinase bound to a…
6DD4 2.1 Å, Crystal Structure of the Human vaccinia-related kinase bound to a…
6CQH 2.15 Å, Crystal Structure of the Human vaccinia-related kinase bound to a…

Browse structure collections

About this viewer

MolViewer shows 9ZKG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.