VRK1 in complex with the inhibitor MP-60. Determined by X-ray diffraction at 2.06 Å resolution. Released 29 Apr 2026.
Explore 9ZKG in 3D Show helices and sheets RCSB PDB PDBe
9ZKG contains 69 α-helices and 50 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 28-30 | 3 | 1 |
| β-strand | 36-42 | 7 | 1 |
| β-strand | 51-56 | 6 | 1 |
| α-helix | 61-62 | 2 | |
| β-strand | 68-74 | 7 | 1 |
| α-helix | 78-90 | 13 | |
| α-helix | 93-102 | 10 | |
| α-helix | 111-112 | 2 | |
| β-strand | 113-121 | 9 | 1 |
| β-strand | 124-132 | 9 | 1 |
| β-strand | 134-137 | 4 | 2 |
| α-helix | 138-144 | 7 | |
| α-helix | 151-170 | 20 | |
| β-strand | 173-174 | 2 | 3 |
| α-helix | 180-182 | 3 | |
| β-strand | 183-186 | 4 | 2 |
| β-strand | 189-195 | 7 | 2 |
| β-strand | 202-203 | 2 | 3 |
| α-helix | 206-208 | 3 | |
| α-helix | 210-212 | 3 | |
| α-helix | 230-233 | 4 | |
| α-helix | 240-256 | 17 | |
| α-helix | 262-264 | 3 | |
| α-helix | 268-280 | 13 | |
| α-helix | 282-289 | 8 | |
| α-helix | 297-307 | 11 | |
| α-helix | 313-315 | 3 | |
| α-helix | 317-330 | 14 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 28-30 | 3 | 4 |
| β-strand | 36-42 | 7 | 4 |
| β-strand | 50-56 | 7 | 4 |
| α-helix | 61-62 | 2 | |
| β-strand | 68-74 | 7 | 4 |
| α-helix | 78-90 | 13 | |
| α-helix | 93-102 | 10 | |
| α-helix | 111-112 | 2 | |
| β-strand | 113-121 | 9 | 4 |
| β-strand | 124-132 | 9 | 4 |
| β-strand | 134-137 | 4 | 5 |
| α-helix | 138-144 | 7 | |
| α-helix | 151-170 | 20 | |
| β-strand | 174 | 1 | 6 |
| α-helix | 180-182 | 3 | |
| β-strand | 183-186 | 4 | 5 |
| β-strand | 189-195 | 7 | 5 |
| β-strand | 202 | 1 | 6 |
| α-helix | 206-208 | 3 | |
| α-helix | 210-212 | 3 | |
| α-helix | 230-233 | 4 | |
| α-helix | 240-256 | 17 | |
| α-helix | 268-280 | 13 | |
| α-helix | 282-289 | 8 | |
| α-helix | 297-307 | 11 | |
| α-helix | 313-315 | 3 | |
| α-helix | 317-330 | 14 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 28-30 | 3 | 7 |
| β-strand | 36-42 | 7 | 7 |
| β-strand | 50-56 | 7 | 7 |
| β-strand | 68-74 | 7 | 7 |
| α-helix | 78-90 | 13 | |
| α-helix | 93-102 | 10 | |
| α-helix | 110-112 | 3 | |
| β-strand | 113-118 | 6 | 7 |
| β-strand | 121 | 1 | 8 |
| β-strand | 124 | 1 | 8 |
| β-strand | 126-132 | 7 | 7 |
| β-strand | 134-137 | 4 | 9 |
| α-helix | 138-144 | 7 | |
| α-helix | 151-170 | 20 | |
| β-strand | 174 | 1 | 10 |
| α-helix | 180-182 | 3 | |
| β-strand | 183-186 | 4 | 9 |
| β-strand | 193-195 | 3 | 9 |
| β-strand | 202 | 1 | 10 |
| α-helix | 206-208 | 3 | |
| α-helix | 210-213 | 4 | |
| β-strand | 215 | 1 | 11 |
| α-helix | 217-219 | 3 | |
| α-helix | 230-233 | 4 | |
| β-strand | 236 | 1 | 11 |
| α-helix | 237-238 | 2 | |
| α-helix | 240-256 | 17 | |
| α-helix | 262-264 | 3 | |
| α-helix | 268-280 | 13 | |
| α-helix | 282-289 | 8 | |
| α-helix | 297-308 | 12 | |
| α-helix | 313-315 | 3 | |
| α-helix | 317-330 | 14 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 28-30 | 3 | 12 |
| β-strand | 36-42 | 7 | 12 |
| β-strand | 50-56 | 7 | 12 |
| α-helix | 61-62 | 2 | |
| β-strand | 68-74 | 7 | 12 |
| α-helix | 79-90 | 12 | |
| α-helix | 93-102 | 10 | |
| α-helix | 111-112 | 2 | |
| β-strand | 113-120 | 8 | 12 |
| β-strand | 125-132 | 8 | 12 |
| β-strand | 134-137 | 4 | 13 |
| α-helix | 138-144 | 7 | |
| α-helix | 151-170 | 20 | |
| β-strand | 173-174 | 2 | 14 |
| α-helix | 180-182 | 3 | |
| β-strand | 183-186 | 4 | 13 |
| β-strand | 189-195 | 7 | 13 |
| β-strand | 202-203 | 2 | 14 |
| α-helix | 206-208 | 3 | |
| α-helix | 209-213 | 5 | |
| β-strand | 215 | 1 | 15 |
| α-helix | 217-219 | 3 | |
| α-helix | 230-233 | 4 | |
| β-strand | 236 | 1 | 15 |
| α-helix | 237-238 | 2 | |
| α-helix | 240-256 | 17 | |
| α-helix | 268-280 | 13 | |
| α-helix | 282-289 | 8 | |
| α-helix | 297-307 | 11 | |
| α-helix | 313-315 | 3 | |
| α-helix | 317-330 | 14 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Serine/threonine-protein kinase VRK1 | A, B, C, D | protein | 364 | Homo sapiens | Q99986 (AlphaFold model) |
>9ZKG_1 Serine/threonine-protein kinase VRK1 (chains A, B, C, D) SMRVKAAQAGRQSSAKRHLAEQFAVGEIITDMAAAAWKVGLPIGQGGFGCIYLADMNSSE SVGSDAPCVVKVEPSDNGPLFTELKFYQRAAKPEQIQKWIRTRKLKYLGVPKYWGSGLHD KNGKSYRFMIMDRFGSDLQKIYEANAKRFSRKTVLQLSLRILDILEYIHEHEYVHGDIKA SNLLLNYKNPDQVYLVDYGLAYRYCPEGVHKAYAADPKRCHDGTIEFTSIDAHNGVAPSR RGDLEILGYCMIQWLTGHLPWEDNLKDPKYVRDSKIRYRENIASLMDKCFPAANAPGEIA KYMETVKLLDYTEKPLYENLRDILLQGLKAIGSKDDGKLDLSVVENGGLKAKTITKKRAA EIEE
| ID | Name | Formula | Copies |
|---|---|---|---|
| ACN | Acetone | C3 H6 O | 1 |
| GG0 | 2-(2-azanylethanoylamino)ethanoic acid | C4 H8 N2 O3 | 2 |
| A1C2O | (5Z)-3-butyl-5-[(3,5-dichloro-4-hydroxyphenyl)methylidene]-1,3-thiazolidine-2,4… | C14 H13 Cl2 N O3 S | 2 |
Water and common crystallization additives (GOL, EDO, CL, PEG, SO4) are not listed.
Structure-based discovery of selective vaccinia-related kinase 1 inhibitors and fluorogenic active-site probes. Crowley-Dolen, E.K., Borges, R.J., Charifson, P.S. et al. J Biol Chem (2026) 302:111355-111355. DOI 10.1016/j.jbc.2026.111355 · PubMed
Other PDB entries of the same protein (UniProt Q99986 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9ZKG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.