9ZU4: BRD9 bromodomain

Crystal structure of BRD9 bromodomain bound to BZ2. Determined by X-ray diffraction at 1.05 Å resolution. Released 16 Sept 2026.

Method: X-ray diffraction
Resolution: 1.05 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,142
Mol. weight: 15.27 kDa
Ligands: XHK
Released: 16 Sept 2026

Explore 9ZU4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9ZU4 contains 7 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	137-139	3
α-helix	140-153	14
α-helix	164-166	3
α-helix	173-175	3
α-helix	183-191	9
α-helix	198-215	18
α-helix	221-236	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Bromodomain-containing protein 9	A	protein	129	Homo sapiens	Q9H8M2 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9ZU4_1 Bromodomain-containing protein 9 (chains A)
MGSSHHHHHHHHHSSGENLYFQGAENESTPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIA
PGYSMIIKHPMDFGTMKDKIVANEYKSVTEFKADFKLMCDNAMTYNRPDTVYYKLAKKIL
HAGFKMMSK

Ligands and cofactors

ID	Name	Formula	Copies
XHK	6-[4-(2-aminoethyl)anilino]-5-chloro-3-methylpyrimidin-4(3H)-one	C13 H15 Cl N4 O	1

Primary citation

Differential Water Networks Guide Selectivity Optimization of a Cell Active BPTF Inhibitor in Neuroblastoma. Babu, K., Tsou, C.J., Das, S. et al. Angew Chem Int Ed Engl (2026):e4580510-e4580510. DOI 10.1002/anie.4580510 · PubMed

Other PDB entries of the same protein (UniProt Q9H8M2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6BQA 1.03 Å, BRD9 bromodomain in complex with 3-(6-(but-3-en-1-yl)-7-oxo-6,7-dihydro-1H-pyrrolo[2,3-c]…
5I40 1.04 Å, BRD9 in complex with Cpd1 (6-methyl-1,6-dihydro-7H-pyrrolo[2,3-c]pyridin-7-one)
9ZU3 1.15 Å, Crystal structure of BRD9 bromodomain bound to BZ1
5I7X 1.18 Å, BRD9 in complex with Cpd2 (N,N-dimethyl-3-(6-methyl-7-oxo-6,7-dihydro-1H-pyrrolo[2,3-c]py…
6Y7K 1.2 Å, Structure of the BRD9 bromodomain and compound 27
4UIT 1.3 Å, BROMODOMAIN OF HUMAN BRD9 WITH 7-(3,4-dimethoxyphenyl)-2-(4-…
6V1B 1.35 Å, Crystal structure of the bromodomain of human BRD9 bound to I-BRD9
5JI8 1.42 Å, Crystal structure of the BRD9 bromodomain and hit 1
4YY6 1.45 Å, Crystal structure of BRD9 Bromodomain bound to a butyryllysine peptide
5I7Y 1.45 Å, BRD9 in complex with Cpd4 ((E)-3-(6-(but-2-en-1-yl)-7-oxo-6,7-dihydro-1H-pyrrolo[2,3-c]py…
4YY4 1.47 Å, Crystal structure of BRD9 Bromodomain bound to DMSO
4YYI 1.5 Å, Crystal structure of BRD9 Bromodomain bound to an acetylated peptide

Browse structure collections

About this viewer

MolViewer shows 9ZU4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.