The structure of human Vacuolar Protein Sorting 34 catalytic domain bound to RD-II-123. Determined by X-ray diffraction at 2.41 Å resolution. Released 25 Mar 2026.
Explore 11YC in 3D Show helices and sheets RCSB PDB PDBe
11YC contains 35 α-helices and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 292-301 | 10 | |
| α-helix | 306-309 | 4 | |
| α-helix | 310-318 | 9 | |
| α-helix | 320-323 | 4 | |
| α-helix | 327-329 | 3 | |
| α-helix | 330-335 | 6 | |
| α-helix | 342-354 | 13 | |
| α-helix | 356-359 | 4 | |
| α-helix | 360-363 | 4 | |
| α-helix | 364-367 | 4 | |
| α-helix | 374-384 | 11 | |
| α-helix | 389-402 | 14 | |
| α-helix | 403-405 | 3 | |
| α-helix | 408-413 | 6 | |
| α-helix | 432-435 | 4 | |
| α-helix | 475-485 | 11 | |
| α-helix | 487-501 | 15 | |
| α-helix | 504-509 | 6 | |
| α-helix | 511-529 | 19 | |
| α-helix | 533-559 | 27 | |
| α-helix | 566-578 | 13 | |
| β-strand | 591-593 | 3 | 1 |
| β-strand | 596-604 | 9 | 1 |
| α-helix | 606-608 | 3 | |
| β-strand | 610-611 | 2 | 1 |
| α-helix | 618 | 1 | |
| β-strand | 619-625 | 7 | 1 |
| β-strand | 630-637 | 8 | 1 |
| α-helix | 642-660 | 19 | |
| β-strand | 672-674 | 3 | 1 |
| β-strand | 679-683 | 5 | 1 |
| β-strand | 688-689 | 2 | 2 |
| α-helix | 690-696 | 7 | |
| α-helix | 700-707 | 8 | |
| β-strand | 709 | 1 | 3 |
| α-helix | 714-716 | 3 | |
| β-strand | 717 | 1 | 3 |
| α-helix | 719-738 | 20 | |
| β-strand | 749-751 | 3 | 2 |
| β-strand | 757-759 | 3 | 2 |
| α-helix | 781-786 | 6 | |
| α-helix | 793-811 | 19 | |
| α-helix | 813-821 | 9 | |
| α-helix | 829-832 | 4 | |
| α-helix | 835-837 | 3 | |
| α-helix | 838-845 | 8 | |
| α-helix | 852-868 | 17 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Phosphatidylinositol 3-kinase catalytic subunit type 3 | B | protein | 594 | Homo sapiens | Q8NEB9 (AlphaFold model) |
>11YC_1 Phosphatidylinositol 3-kinase catalytic subunit type 3 (chains B) MGHHHHHHHHHHAATRDQLNIIVSYPPTKQLTYEEQDLVWKFRYYLTNQEKALTKFLKCV NWDLPQEAKQALELLGKWKPMDVEDSLELLSSHYTNPTVRRYAVARLRQADDEDLLMYLL QLVQALKYENFDDIKNGLEPTKKDSQSSVSENVSNSGINSAEIDSSQIITSPLPSVSSPP PASKTKEVPDGENLEQDLCTFLISRACKNSTLANYLYWYVIVECEDQDTQQRDPKTHEMY LNVMRRFSQALLKGDKSVRVMRSLLAAQQTFVDRLVHLMKAVQRESGNRKKKNERLQALL GDNEKMNLSDVELIPLPLEPQVKIRGIIPETATLFKSALMPAQLFFKTEDGGKYPVIFKH GDDLRQDQLILQIISLMDKLLRKENLDLKLTPYKVLATSTKHGFMQFIQSVPVAEVLDTE GSIQNFFRKYAPSENGPNGISAEVMDTYVKSCAGYCVITYILGVGDRHLDNLLLTKTGKL FHIDFGYILGRDPKPLPPPMKLNKEMVEGMGGTQSEQYQEFRKQCYTAFLHLRRYSNLIL NLFSLMVDANIPDIALEPDKTVKKVQDKFRLDLSDEEAVHYMQSLIDESVHALF
| ID | Name | Formula | Copies |
|---|---|---|---|
| A1DAY | (8S)-3-(6-butyl-1,3-benzothiazol-2-yl)pyrazolo[1,5-a]pyrimidine | C17 H16 N4 S | 1 |
Water and common crystallization additives (CL, PEG, EDO) are not listed.
The structure of human Vacuolar Protein Sorting 34 catalytic domain bound to RD-II-123. Abiodun, W.O., Litchfield, C.M., Burtch, M. et al. To be published.
Other PDB entries of the same protein (UniProt Q8NEB9 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 11YC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.