12LO: Protein GB1 mutant K13A
X-ray crystal structure of Protein GB1 mutant K13A. Determined by X-ray diffraction at 1.37 Å resolution. Released 22 Jul 2026.
- Method
- X-ray diffraction
- Resolution
- 1.37 Å
- Organism
- Streptococcus sp. group G
- Chains
- 1
- Atoms
- 525
- Mol. weight
- 6.17 kDa
- Released
- 22 Jul 2026
Explore 12LO in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
12LO contains 1 α-helix and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 1 helix, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 2-8 | 7 | 1 |
| β-strand | 13-19 | 7 | 1 |
| α-helix | 23-36 | 14 | |
| β-strand | 42-46 | 5 | 1 |
| β-strand | 51-55 | 5 | 1 |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Immunoglobulin G-binding protein G | A | protein | 56 | Streptococcus sp. group G | P19909 (AlphaFold model) |
Sequence of entity 1 (A), FASTA
>12LO_1 Immunoglobulin G-binding protein G (chains A)
MQYKLILNGKTLAGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTE
Primary citation
X-ray crystal structure of Protein GB1 mutant K13A. Roose, B.W., Christianson, D.W. To be published.
Other PDB entries of the same protein (UniProt P19909 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 3FIL 0.88 Å, Structural and energetic determinants for hyperstable variants of GB1 obtained from…
- 2QMT 1.05 Å, Crystal Polymorphism of Protein GB1 Examined by Solid-state NMR and X-ray Diffraction
- 9I2I 1.08 Å, X-ray structure of the B1 domain of streptococcal protein G triple mutant T2Q, N8D, and…
- 6CHE 1.1 Å, Selenomethionine mutant (A34Sem) of protein GB1 examined by X-ray diffraction
- 6CPZ 1.12 Å, Selenomethionine mutant (I6Sem) of protein GB1 examined by X-ray diffraction
- 2GI9 1.14 Å, Backbone Conformational Constraints in a Microcrystalline U-15N-Labeled Protein by 3D…
- 6C9O 1.2 Å, Selenomethionine mutant (V29Sem) of protein GB1 examined by X-ray diffraction
- 6CTE 1.2 Å, 77Se-NMR probes the protein environment of selenomethionine
- 6OC7 1.3 Å, HMP42 Fab in complex with Protein G
- 6NLA 1.34 Å, Crystal structure of de novo designed metal-controlled dimer of B1…
- 2ON8 1.35 Å, Gbeta1 stabilization by in vitro evolution and computational design
- 6NL6 1.4 Å, Crystal structure of mutant B1 immunoglobulin-binding domain of Streptococcal Protein G…
Browse structure collections
About this viewer
MolViewer shows 12LO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.