1A06: Calmodulin-dependent protein kinase from rat

Name: PDB 1A06: Calmodulin-dependent protein kinase from rat
Published: 1998-04-08
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: kinase

Calmodulin-dependent protein kinase from rat. Determined by X-ray diffraction at 2.5 Å resolution. Released 8 Apr 1998.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Rattus norvegicus
Chains: 1
Atoms: 2,343
Mol. weight: 37.52 kDa
Released: 8 Apr 1998

Explore 1A06 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1A06 contains 17 α-helices and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 17 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	11-12	2	1
α-helix	16-18	3
β-strand	20-25	6	1
β-strand	27	1	2
α-helix	29-33	5
β-strand	34-39	6	1
β-strand	45-52	8	1
α-helix	65-71	7
β-strand	78	1	3
β-strand	81-86	6	1
β-strand	90-95	6	1
α-helix	96-97	2
β-strand	102	1	3
α-helix	103-108	6
α-helix	115-134	20
α-helix	144-146	3
β-strand	147-149	3	3
α-helix	156-157	2
β-strand	158-160	3	3
α-helix	187-190	4
α-helix	198-213	16
α-helix	223-231	9
α-helix	247-256	10
α-helix	261-263	3
α-helix	265-266	2
α-helix	267-272	6
α-helix	287-297	11
β-strand	307	1	2
α-helix	309-315	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Calcium/calmodulin-dependent protein kinase	A	protein	332	Rattus norvegicus	Q63450 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1A06_1 CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE (chains A)
MPGAVEGPRWKQAEDIRDIYDFRDVLGTGAFSEVILAEDKRTQKLVAIKCIAKKALEGKE
GSMENEIAVLHKIKHPNIVALDDIYESGGHLYLIMQLVSGGELFDRIVEKGFYTERDASR
LIFQVLDAVKYLHDLGIVHRDLKPENLLYYSLDEDSKIMISDFGLSKMEDPGSVLSTACG
TPGYVAPEVLAQKPYSKAVDCWSIGVIAYILLCGYPPFYDENDAKLFEQILKAEYEFDSP
YWDDISDSAKDFIRHLMEKDPEKRFTCEQALQHPWIAGDTALDKNIHQSVSEQIKKNFAK
SKWKQAFNATAVVRHMRKLQLGHQPGGTGTDS

Primary citation

Structural basis for the autoinhibition of calcium/calmodulin-dependent protein kinase I. Goldberg, J., Nairn, A.C., Kuriyan, J. Cell (1996) 84:875-887. DOI 10.1016/S0092-8674(00)81066-1 · PubMed

Other PDB entries of the same protein (UniProt Q63450 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1MXE 1.7 Å, Structure of the Complex of Calmodulin with the Target Sequence of CaMKI
2L7L Solution structure of Ca2+/calmodulin complexed with a peptide representing the…

Browse structure collections

About this viewer

MolViewer shows 1A06 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.