1MXE: Calmodulin

Structure of the Complex of Calmodulin with the Target Sequence of CaMKI. Determined by X-ray diffraction at 1.7 Å resolution. Released 4 Dec 2002.

Method: X-ray diffraction
Resolution: 1.7 Å
Organism: Drosophila melanogaster
Chains: 4
Atoms: 2,922
Mol. weight: 39.7 kDa
Ligands: CA
Released: 4 Dec 2002

Explore 1MXE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1MXE contains 18 α-helices and 8 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	6-19	14
β-strand	26-27	2	1
α-helix	29-38	10
α-helix	45-55	11
β-strand	63-64	2	1
α-helix	65-78	14
α-helix	81-92	12
β-strand	99-100	2	2
α-helix	102-111	10
α-helix	118-128	11
β-strand	136-137	2	2
α-helix	138-146	9

Chain B: 8 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	6-19	14
β-strand	26-27	2	3
α-helix	29-38	10
α-helix	45-55	11
β-strand	63-64	2	3
α-helix	65-77	13
α-helix	81-92	12
β-strand	100	1	4
α-helix	102-111	10
α-helix	118-128	11
β-strand	136	1	4
α-helix	138-146	9

Chains E and F: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	298-317	20

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Calmodulin	A, B	protein	148	Drosophila melanogaster	P62152 (AlphaFold model)
Target Sequence of rat Calmodulin-Dependent Protein Kinase I	E, F	protein	25		Q63450 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1MXE_1 Calmodulin (chains A, B)
ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGN
GTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEE
VDEMIREADIDGDGQVNYEEFVTMMTSK

Sequence of entity 2 (E, F), FASTA

>1MXE_2 Target Sequence of rat Calmodulin-Dependent Protein Kinase I (chains E, F)
IKKNFAKSKWKQAFNATAVVRHMRK

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	8

Primary citation

Structure of the Complex of Calmodulin with the Target Sequence of Calmodulin-Dependent Protein Kinase I: Studies of the Kinase Activation Mechanism. Clapperton, J.A., Martin, S.R., Smerdon, S.J. et al. Biochemistry (2002) 41:14669-14679. DOI 10.1021/bi026660t · PubMed

Other PDB entries of the same protein (UniProt P62152 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7CQH 2.15 Å, Complex of TRP_CBS2 and Calmodulin_Clobe
2X51 2.2 Å, M6 delta Insert1
3L9I 2.2 Å, Myosin VI nucleotide-free (mdinsert2) L310G mutant crystal structure
4CLN 2.2 Å, Structure of a recombinant calmodulin from drosophila melanogaster refined at 2.2-Å…
4DBP 2.2 Å, Myosin VI nucleotide-free (MDINSERT2) D179Y crystal structure
8ZLW 2.2 Å, Crystal Structure of RDGC IQ motif/dCaM Complex
2BKH 2.4 Å, Myosin VI nucleotide-free (MDInsert2) crystal structure
2VAS 2.4 Å, Myosin VI (MD-insert2-CaM, Delta-Insert1) Post-rigor state
4PJJ 2.4 Å, MYOSIN VI (MD-INSERT2-CAM, DELTA-INSERT1) post-rigor state - long soaking with PO4
4ANJ 2.6 Å, MYOSIN VI (MDinsert2-GFP fusion) PRE-POWERSTROKE STATE (MG.ADP.AlF4)
4DBQ 2.6 Å, MYOSIN VI D179Y (MD-INSERT2-CAM, DELTA-INSERT1) post-rigor state
3GN4 2.7 Å, Myosin lever arm

Browse structure collections

About this viewer

MolViewer shows 1MXE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.