1A12: Regulator of chromosome condensation 1

Regulator of chromosome condensation (RCC1) of human. Determined by X-ray diffraction at 1.7 Å resolution. Released 13 Jan 1999.

Method: X-ray diffraction
Resolution: 1.7 Å
Organism: Homo sapiens
Chains: 3
Atoms: 9,884
Mol. weight: 132.33 kDa
Released: 13 Jan 1999

Explore 1A12 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1A12 contains 21 α-helices and 106 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 36 β-strands

Element	Residues	Length	Sheet
β-strand	35	1	1
β-strand	36-42	7	2
β-strand	56-63	8	2
α-helix	64	1
β-strand	69-74	6	1
β-strand	78-83	6	1
β-strand	88-92	5	1
α-helix	108-110	3
β-strand	113-114	2	1
β-strand	121-126	6	3
β-strand	130-135	6	3
β-strand	140-144	5	3
β-strand	146-148	3	4
β-strand	151-154	4	4
β-strand	157	1	5
β-strand	158	1	4
β-strand	160	1	5
β-strand	162-168	7	3
β-strand	174-179	6	6
β-strand	183-188	6	6
β-strand	193-197	5	6
α-helix	208-210	3
α-helix	216-219	4
α-helix	220-224	5
β-strand	227-228	2	6
β-strand	232	1	7
β-strand	239	1	7
β-strand	242-248	7	8
β-strand	251-256	6	8
β-strand	261-265	5	8
β-strand	280-285	6	8
α-helix	287-289	3
β-strand	296-301	6	9
β-strand	305-310	6	9
β-strand	315-319	5	9
α-helix	322-324	3
β-strand	335-340	6	9
β-strand	347-352	6	10
β-strand	356-361	6	10
β-strand	366-370	5	10
β-strand	385-390	6	10
β-strand	399-406	8	2
β-strand	410-417	8	2

Chain B: 9 helices, 34 β-strands

Element	Residues	Length	Sheet
β-strand	35	1	11
β-strand	36-42	7	12
β-strand	56-63	8	12
β-strand	69-74	6	11
β-strand	78-83	6	11
β-strand	88-92	5	11
β-strand	113-115	3	11
α-helix	116	1
α-helix	120	1
β-strand	121-126	6	13
β-strand	130-135	6	13
β-strand	140-144	5	13
β-strand	146-147	2	14
β-strand	152-154	3	14
β-strand	157	1	15
β-strand	158	1	14
β-strand	160	1	15
β-strand	162-167	6	13
β-strand	174-179	6	16
β-strand	183-188	6	16
β-strand	193-197	5	16
α-helix	209-211	3
α-helix	216-218	3
α-helix	221-224	4
β-strand	227-228	2	16
β-strand	242-248	7	17
β-strand	251-256	6	17
α-helix	260	1
β-strand	261-265	5	17
β-strand	280-285	6	17
α-helix	287-289	3
β-strand	296-301	6	18
β-strand	305-310	6	18
β-strand	315-319	5	18
α-helix	322-324	3
β-strand	335-340	6	18
β-strand	347-352	6	19
β-strand	356-361	6	19
β-strand	366-370	5	19
β-strand	385-390	6	19
α-helix	394-396	3
β-strand	399-406	8	12
β-strand	410-417	8	12

Chain C: 5 helices, 36 β-strands

Element	Residues	Length	Sheet
β-strand	35	1	20
β-strand	36-42	7	21
β-strand	56-62	7	21
β-strand	69-74	6	20
β-strand	78-83	6	20
β-strand	88-92	5	20
α-helix	108-110	3
β-strand	113-114	2	20
β-strand	121-126	6	22
β-strand	130-135	6	22
β-strand	140-144	5	22
β-strand	146-147	2	23
β-strand	152-154	3	23
β-strand	157	1	24
β-strand	158	1	23
β-strand	160	1	24
β-strand	162-167	6	22
β-strand	174-179	6	25
β-strand	183-188	6	25
β-strand	193-197	5	25
α-helix	216-218	3
α-helix	221-224	4
β-strand	227-228	2	25
β-strand	232	1	26
β-strand	239	1	26
β-strand	242-248	7	27
β-strand	251-256	6	27
β-strand	261-265	5	27
β-strand	280-285	6	27
α-helix	287-289	3
β-strand	296-301	6	28
β-strand	305-310	6	28
β-strand	315-319	5	28
α-helix	322-324	3
β-strand	335-340	6	28
β-strand	347-353	7	29
β-strand	356-361	6	29
β-strand	366-370	5	29
β-strand	385-390	6	29
β-strand	399-406	8	21
β-strand	410-417	8	21

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Regulator of chromosome condensation 1	A, B, C	protein	413	Homo sapiens	P18754 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>1A12_1 REGULATOR OF CHROMOSOME CONDENSATION 1 (chains A, B, C)
RRSPPADAIPKSKKVKVSHRSHSTEPGLVLTLGQGDVGQLGLGENVMERKKPALVSIPED
VVQAEAGGMHTVCLSKSGQVYSFGCNDEGALGRDTSVEGSEMVPGKVELQEKVVQVSAGD
SHTAALTDDGRVFLWGSFRDNNGVIGLLEPMKKSMVPVQVQLDVPVVKVASGNDHLVMLT
ADGDLYTLGCGEQGQLGRVPELFANRGGRQGLERLLVPKCVMLKSRGSRGHVRFQDAFCG
AYFTFAISHEGHVYGFGLSNYHQLGTPGTESCFIPQNLTSFKNSTKSWVGFSGGQHHTVC
MDSEGKAYSLGRAEYGRLGLGEGAEEKSIPTLISRLPAVSSVACGASVGYAVTKDGRVFA
WGMGTNYQLGTGQDEDAWSPVEMMGKQLENRVVLSVSSGGQHTVLLVKDKEQS

Primary citation

The 1.7 A crystal structure of the regulator of chromosome condensation (RCC1) reveals a seven-bladed propeller. Renault, L., Nassar, N., Vetter, I. et al. Nature (1998) 392:97-101. DOI 10.1038/32204 · PubMed

Other PDB entries of the same protein (UniProt P18754 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6DUB 1.2 Å, Crystal structure of a methyltransferase
5E1D 1.45 Å, NTMT1 in complex with YPKRIA peptide
5E1B 1.65 Å, Crystal structure of NRMT1 in complex with SPKRIA peptide
5E1M 1.75 Å, Crystal structure of NTMT1 in complex with PPKRIA peptide
5E2A 1.75 Å, Crystal structure of NTMT1 in complex with N-terminally methylated SPKRIA peptide
1I2M 1.76 Å, Ran-RCC1-SO4 complex
5E2B 1.95 Å, Crystal structure of NTMT1 in complex with N-terminally methylated PPKRIA peptide
5E1O 2.0 Å, Crystal structure of NTMT1 in complex with RPKRIA peptide
8UX1 2.5 Å, Cryo-EM structure of Ran bound to RCC1 and the nucleosome core particle
5TBK 3.45 Å, Crystal structure of human importin a3 bound to RCC1

Browse structure collections

About this viewer

MolViewer shows 1A12 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.