1A19: Barstar (FREE), C82A mutant

Barstar (FREE), C82A mutant. Determined by X-ray diffraction at 2.76 Å resolution. Released 8 Apr 1998.

Method: X-ray diffraction
Resolution: 2.76 Å
Organism: Bacillus amyloliquefaciens
Chains: 2
Atoms: 1,438
Mol. weight: 20.64 kDa
Released: 8 Apr 1998

Explore 1A19 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1A19 contains 10 α-helices and 6 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	2-6	5	1
α-helix	13-23	11
α-helix	34-39	6
α-helix	40-44	5
α-helix	46	1
β-strand	49-54	6	1
α-helix	56-61	6
α-helix	67-80	14
β-strand	84-88	5	1

Chain B: 4 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	2-6	5	1
α-helix	13-23	11
α-helix	34-41	8
β-strand	49-54	6	1
α-helix	56-61	6
α-helix	67-80	14
β-strand	84-88	5	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Barstar	A, B	protein	90	Bacillus amyloliquefaciens	P11540 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1A19_1 BARSTAR (chains A, B)
MKKAVINGEQIRSISDLHQTLKKELALPEYYGENLDALWDCLTGWVEYPLVLEWRQFEQS
KQLTENGAESVLQVFREAKAEGADITIILS

Primary citation

Discrepancies between the NMR and X-ray structures of uncomplexed barstar: analysis suggests that packing densities of protein structures determined by NMR are unreliable. Ratnaparkhi, G.S., Ramachandran, S., Udgaonkar, J.B. et al. Biochemistry (1998) 37:6958-6966. DOI 10.1021/bi972857n · PubMed

Other PDB entries of the same protein (UniProt P11540 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6PQK 1.2 Å, Cryogenic crystal structure of barnase A43C/S80C bound to barstar C40A/S59C/A67C/C82A
2ZA4 1.58 Å, Crystal Structural Analysis of Barnase-barstar Complex
1AY7 1.7 Å, Ribonuclease sa complex with barstar
1B2S 1.82 Å, Structural response to mutation at a protein-protein interface
1X1Y 1.9 Å, Water-mediate interaction at aprotein-protein interface
1BRS 2.0 Å, Protein-protein recognition: crystal structural analysis of a barnase-barstar complex at…
2HXX 2.0 Å, Aminotryptophan Barstar
1B27 2.1 Å, Structural response to mutation at a protein-protein interface
1B2U 2.1 Å, Structural response to mutation at a protein-protein interface
1X1W 2.1 Å, Water-mediate interaction at aprotein-protein interface
3DA7 2.25 Å, A conformationally strained, circular permutant of barnase
7MRX 2.29 Å, Cryogenic crystal structure of barnase A43C/S80C bound to barstar C40A/C82A

Browse structure collections

About this viewer

MolViewer shows 1A19 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.