1AY7: Ribonuclease sa complex with barstar

Ribonuclease sa complex with barstar. Determined by X-ray diffraction at 1.7 Å resolution. Released 2 Mar 1999.

Method: X-ray diffraction
Resolution: 1.7 Å
Organisms: Streptomyces aureofaciens, Bacillus amyloliquefaciens
Chains: 2
Atoms: 1,678
Mol. weight: 20.8 kDa
Released: 2 Mar 1999

Explore 1AY7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1AY7 contains 8 α-helices and 9 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	5-7	3	1
α-helix	8-10	3
α-helix	13-23	11
β-strand	36	1	1
α-helix	45-46	2
β-strand	53-56	4	1
β-strand	69-72	4	1
β-strand	79-82	4	1
β-strand	90-93	4	1

Chain B: 5 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	2-6	5	2
α-helix	7-9	3
α-helix	13-23	11
α-helix	34-43	10
β-strand	49-54	6	2
α-helix	56-62	7
α-helix	66-79	14
β-strand	84-88	5	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Guanyl-specific ribonuclease sa	A	protein	96	Streptomyces aureofaciens	P05798 (AlphaFold model)
Barstar	B	protein	89	Bacillus amyloliquefaciens	P11540 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1AY7_1 GUANYL-SPECIFIC RIBONUCLEASE SA (chains A)
DVSGTVCLSALPPEATDTLNLIASDGPFPYSQDGVVFQNRESVLPTQSYGYYHEYTVITP
GARTRGTRRIITGEATQEDYYTGDHYATFSLIDQTC

Sequence of entity 2 (B), FASTA

>1AY7_2 BARSTAR (chains B)
KKAVINGEQIRSISDLHQTLKKELALPEYYGENLDALWDCLTGWVEYPLVLEWRQFEQSK
QLTENGAESVLQVFREAKAEGCDITIILS

Primary citation

Recognition of RNase Sa by the inhibitor barstar: structure of the complex at 1.7 A resolution. Sevcik, J., Urbanikova, L., Dauter, Z. et al. Acta Crystallogr D Biol Crystallogr (1998) 54:954-963. DOI 10.1107/S0907444998004429 · PubMed

Other PDB entries of the same protein (UniProt P05798 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1LNI 1.0 Å, Crystal structure analysis of a ribonuclease from streptomyces aureofaciens at atomic…
1T2H 1.0 Å, Y81W mutant of RNase Sa from Streptomyces aureofaciens
1T2I 1.1 Å, T76W mutant of RNase Sa from Streptomyces aureofaciens
4GHO 1.1 Å, Crystal Structure Analysis of Streptomyces aureofaciens Ribonuclease S24A mutant
1ZGX 1.13 Å, Crystal structure of ribonuclease mutant
1RGE 1.15 Å, Hydrolase, guanyloribonuclease
1RGF 1.2 Å, Hydrolase, guanyloribonuclease
1RGG 1.2 Å, Hydrolase, guanyloribonuclease
1RGH 1.2 Å, Hydrolase, guanyloribonuclease
1YNV 1.2 Å, Asp79 makes a large, unfavorable contribution to the stability of RNase Sa
4J5K 1.23 Å, Crystal structure analysis of Streptomyces aureofaciens ribonuclease Sa Y51F mutant
1I8V 1.25 Å, Crystal structure of RNase sa Y80F mutant

Browse structure collections

About this viewer

MolViewer shows 1AY7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.