1A1H: Qgsr (ZIF268 variant) zinc finger-DNA complex

Qgsr (ZIF268 variant) zinc finger-DNA complex (gcac site). Determined by X-ray diffraction at 1.6 Å resolution. Released 10 Jun 1998.

Method: X-ray diffraction
Resolution: 1.6 Å
Organism: Mus musculus
Chains: 3
Atoms: 1,311
Mol. weight: 17.63 kDa
Ligands: ZN
Released: 10 Jun 1998

Explore 1A1H in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1A1H contains 4 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	105-106	2	1
β-strand	115-116	2	1
α-helix	119-130	12
β-strand	135-136	2	2
β-strand	143-144	2	2
α-helix	147-158	12
β-strand	163-164	2	3
β-strand	171-172	2	3
α-helix	175-182	8
α-helix	183-186	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA (5'-d(apgpcpgptpgpgpgpcpap*c)-3')	B	DNA	11
DNA (5'-d(tpgptpgpcpcpcpapcpgp*c)-3')	C	DNA	11
Qgsr zinc finger peptide	A	protein	90	Mus musculus	P08046 (AlphaFold model)

Sequence of entity 1 (B), FASTA

>1A1H_1 DNA (5'-D(*AP*GP*CP*GP*TP*GP*GP*GP*CP*AP*C)-3') (chains B)
AGCGTGGGCAC

Sequence of entity 2 (C), FASTA

>1A1H_2 DNA (5'-D(*TP*GP*TP*GP*CP*CP*CP*AP*CP*GP*C)-3') (chains C)
TGTGCCCACGC

Sequence of entity 3 (A), FASTA

>1A1H_3 QGSR ZINC FINGER PEPTIDE (chains A)
MERPYACPVESCDRRFSQSGSLTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGE
KPFACDICGRKFARSDERKRHTKIHLRQKD

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	3

Primary citation

High-resolution structures of variant Zif268-DNA complexes: implications for understanding zinc finger-DNA recognition. Elrod-Erickson, M., Benson, T.E., Pabo, C.O. Structure (1998) 6:451-464. DOI 10.1016/S0969-2126(98)00047-1 · PubMed

Other PDB entries of the same protein (UniProt P08046 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1LLM 1.5 Å, Crystal Structure of a Zif23-GCN4 Chimera Bound to DNA
1A1I 1.6 Å, Radr (ZIF268 variant) zinc finger-DNA complex (gcac site)
1AAY 1.6 Å, ZIF268 zinc finger-DNA complex
1JK2 1.65 Å, Zif268 D20A mutant bound to the GCT DNA site
1A1G 1.9 Å, Dsnr (ZIF268 variant) zinc finger-DNA complex (gcgt site)
1A1K 1.9 Å, Radr (ZIF268 variant) zinc finger-DNA complex (gacc site)
1JK1 1.9 Å, Zif268 D20A Mutant Bound to WT DNA Site
1A1J 2.0 Å, Radr (ZIF268 variant) zinc finger-DNA complex (gcgt site)
1G2F 2.0 Å, Structure of a CYS2HIS2 zinc finger/tata box complex (tatazf;clone #6)
1A1F 2.1 Å, Dsnr (ZIF268 variant) zinc finger-DNA complex (gacc site)
1ZAA 2.1 Å, Zinc finger-DNA recognition: crystal structure of a ZIF268-DNA complex at 2.1 Å
1G2D 2.2 Å, Structure of a CYS2HIS2 zinc finger/tata box complex (clone #2)

Browse structure collections

About this viewer

MolViewer shows 1A1H directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.