1LLM: Zif23-GCN4 Chimera

Crystal Structure of a Zif23-GCN4 Chimera Bound to DNA. Determined by X-ray diffraction at 1.5 Å resolution. Released 30 Sept 2003.

Method: X-ray diffraction
Resolution: 1.5 Å
Organisms: Mus musculus, Saccharomyces cerevisiae
Chains: 4
Atoms: 2,323
Mol. weight: 29.31 kDa
Ligands: ZN
Released: 30 Sept 2003

Explore 1LLM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1LLM contains 8 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain C: 4 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	104-105	2	1
β-strand	112-113	2	1
α-helix	116-127	12
β-strand	132-133	2	2
β-strand	140-141	2	2
α-helix	144-151	8
α-helix	152-156	5
α-helix	157-184	28

Chain D: 4 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	204-205	2	3
β-strand	212-213	2	3
α-helix	216-227	12
β-strand	232-233	2	4
β-strand	240-241	2	4
α-helix	244-251	8
α-helix	252-256	5
α-helix	257-284	28

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
5'-d(tpcpcpcpapcpgpcpgptpgpgp*g)-3'	A, B	DNA	13
chimera of Zif23-GCN4	C, D	protein	88	Mus musculus, Saccharomyces cerevisiae	P03069 (AlphaFold model), P08046 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1LLM_1 5'-D(*TP*CP*CP*CP*AP*CP*GP*CP*GP*TP*GP*GP*G)-3' (chains A, B)
TCCCACGCGTGGG

Sequence of entity 2 (C, D), FASTA

>1LLM_2 chimera of Zif23-GCN4 (chains C, D)
MKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHRDIQHILPIL
EDKVEELLSKNYHLENEVARLKKLVGER

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	4

Primary citation

Structure of a designed dimeric zinc finger protein bound to DNA. Wolfe, S.A., Grant, R.A., Pabo, C.O. Biochemistry (2003) 42:13401-13409. DOI 10.1021/bi034830b · PubMed

Other PDB entries of the same protein (UniProt P03069 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3AZD 0.98 Å, Crystal structure of tropomyosin N-terminal fragment at 0.98A resolution
2WQ1 1.08 Å, GCN4 leucine zipper mutant with three IxxNTxx motifs coordinating bromide
2WQ0 1.12 Å, GCN4 leucine zipper mutant with three IxxNTxx motifs coordinating chloride
4OWI 1.2 Å, peptide structure
2WQ3 1.22 Å, GCN4 leucine zipper mutant with three IxxNTxx motifs coordinating chloride and nitrate
2HY6 1.25 Å, A seven-helix coiled coil
2WPZ 1.25 Å, GCN4 leucine zipper mutant with two VxxNxxx motifs coordinating chloride
6PSA 1.3 Å, PIE12 D-peptide against HIV entry (in complex with IQN17 Q577R resistance mutant)
2IPZ 1.35 Å, A Parallel Coiled-Coil Tetramer with Offset Helices
2YNY 1.35 Å, Salmonella enterica SadA 255-302 fused to GCN4 adaptors (SadAK1)
5APU 1.35 Å, Sequence IANKEDKAD inserted between GCN4 adaptors - Structure A9b black
2WQ2 1.36 Å, GCN4 leucine zipper mutant with three IxxNTxx motifs coordinating iodide

Browse structure collections

About this viewer

MolViewer shows 1LLM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.