Hepatitis C virus NS3 helicase domain complexed with single stranded sdna. Determined by X-ray diffraction at 2.2 Å resolution. Released 13 Jan 1999.
Explore 1A1V in 3D Show helices and sheets RCSB PDB PDBe
1A1V contains 18 α-helices and 26 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 198-203 | 6 | 1 |
| α-helix | 213-219 | 7 | |
| β-strand | 225-229 | 5 | 1 |
| α-helix | 232-246 | 15 | |
| β-strand | 251-253 | 3 | 1 |
| β-strand | 258-259 | 2 | 1 |
| β-strand | 265-269 | 5 | 1 |
| α-helix | 270-275 | 6 | |
| α-helix | 278-281 | 4 | |
| β-strand | 286-290 | 5 | 1 |
| α-helix | 297-309 | 13 | |
| β-strand | 317-322 | 6 | 1 |
| β-strand | 336-340 | 5 | 2 |
| β-strand | 347-349 | 3 | 3 |
| β-strand | 352-354 | 3 | 3 |
| α-helix | 357-360 | 4 | |
| β-strand | 363-367 | 5 | 2 |
| α-helix | 371-383 | 13 | |
| β-strand | 388-391 | 4 | 2 |
| α-helix | 397-399 | 3 | |
| β-strand | 406-410 | 5 | 2 |
| β-strand | 422 | 1 | 4 |
| β-strand | 424-427 | 4 | 2 |
| β-strand | 430-437 | 8 | 5 |
| β-strand | 445-452 | 8 | 5 |
| β-strand | 454 | 1 | 6 |
| α-helix | 455-462 | 8 | |
| β-strand | 465 | 1 | 4 |
| β-strand | 471-475 | 5 | 2 |
| β-strand | 481 | 1 | 6 |
| α-helix | 482 | 1 | |
| β-strand | 485 | 1 | 7 |
| α-helix | 488-500 | 13 | |
| α-helix | 506-518 | 13 | |
| β-strand | 524 | 1 | 7 |
| α-helix | 529-538 | 10 | |
| α-helix | 544-552 | 9 | |
| α-helix | 558-571 | 14 | |
| α-helix | 580-585 | 6 | |
| α-helix | 589-591 | 3 | |
| β-strand | 596-597 | 2 | 8 |
| β-strand | 601 | 1 | 5 |
| β-strand | 609-610 | 2 | 8 |
| α-helix | 614-623 | 10 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| DNA (5'-d(*up*up*up*up*up*up*up*u)-3') | B | DNA | 8 | ||
| Protein (NS3 protein) | A | protein | 476 | Hepatitis C virus (isolate H) | P27958 (AlphaFold model) |
>1A1V_1 DNA (5'-D(*UP*UP*UP*UP*UP*UP*UP*U)-3') (chains B) UUUUUUUU
>1A1V_2 PROTEIN (NS3 PROTEIN) (chains A) MVDFIPVENLETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKV LVLNPSVAATLGFGAYMSKAHGVDPNIRTGVRTITTGSPITYSTYGKFLADGGCSGGAYD IIICDECHSTDATSILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSTTG EIPFYGKAIPLEVIKGGRHLIFCHSKKKCDELAAKLVALGINAVAYYRGLDVSVIPTSGD VVVVATDALMTGFTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTLPQDAVSRTQRRGRT GRGKPGIYRFVAPGERPSGMFDSSVLCECYDAGCAWYELTPAETTVRLRAYMNTPGLPVC QDHLEFWEGVFTGLTHIDAHFLSQTKQSGENFPYLVAYQATVCARAQAPPPSWDQMWKCL IRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMTCMSADLEVVTGSGSHHHHHH
Hepatitis C virus NS3 RNA helicase domain with a bound oligonucleotide: the crystal structure provides insights into the mode of unwinding. Kim, J.L., Morgenstern, K.A., Griffith, J.P. et al. Structure (1998) 6:89-100. DOI 10.1016/S0969-2126(98)00010-0 · PubMed
Other PDB entries of the same protein (UniProt P27958 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1A1V directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.