1A3Q: Human nf-kappa-B P52

Human nf-kappa-B P52 bound to DNA. Determined by X-ray diffraction at 2.1 Å resolution. Released 11 Jun 1998.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Homo sapiens
Chains: 4
Atoms: 5,748
Mol. weight: 71.12 kDa
Released: 11 Jun 1998

Explore 1A3Q in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1A3Q contains 20 α-helices and 60 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 30 β-strands

Element	Residues	Length	Sheet
β-strand	39-44	6	1
α-helix	45	1
β-strand	46	1	2
α-helix	47	1
β-strand	51	1	3
α-helix	52-53	2
β-strand	54-55	2	4
β-strand	67	1	2
β-strand	79-83	5	1
β-strand	89-96	8	5
β-strand	104	1	5
β-strand	108-111	4	4
β-strand	114	1	5
β-strand	120-124	5	5
β-strand	130-132	3	1
β-strand	136-140	5	4
α-helix	141-142	2
α-helix	146-158	13
α-helix	168-182	15
β-strand	189-190	2	6
β-strand	191-198	8	5
β-strand	207-208	2	5
β-strand	212-213	2	5
β-strand	217-218	2	6
β-strand	219	1	3
β-strand	230-233	4	7
β-strand	237-239	3	8
β-strand	245-250	6	7
β-strand	258-264	7	8
β-strand	270-273	4	8
β-strand	275	1	7
α-helix	278-280	3
β-strand	281-282	2	7
β-strand	286-290	5	7
α-helix	291-294	4
β-strand	303-311	9	8
β-strand	317	1	8
α-helix	318-320	3
β-strand	321-326	6	8

Chain B: 11 helices, 30 β-strands

Element	Residues	Length	Sheet
β-strand	39-44	6	9
α-helix	45	1
β-strand	46	1	10
α-helix	47	1
β-strand	51	1	11
β-strand	54-55	2	12
α-helix	56-58	3
β-strand	67	1	10
β-strand	79-83	5	9
β-strand	89-96	8	13
β-strand	104	1	13
β-strand	108-111	4	12
β-strand	114	1	13
β-strand	120-124	5	13
β-strand	130-132	3	9
β-strand	136-140	5	12
α-helix	143-161	19
α-helix	168-174	7
α-helix	179-182	4
β-strand	189-190	2	14
β-strand	191-198	8	13
β-strand	207-208	2	13
α-helix	209-211	3
β-strand	212-213	2	13
β-strand	217-218	2	14
β-strand	219	1	11
α-helix	223-225	3
α-helix	226-228	3
β-strand	230-233	4	15
β-strand	237-239	3	16
β-strand	245-250	6	15
β-strand	259-264	6	16
β-strand	270-273	4	16
β-strand	275	1	15
α-helix	278-280	3
β-strand	281	1	15
β-strand	286-290	5	15
α-helix	291-294	4
β-strand	303-310	8	16
β-strand	317	1	16
β-strand	321-326	6	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA (5'-d(gpgpgpgpapaptpcpcpcp*c)-3')	C	DNA	11
DNA (5'-d(gpgpgpgpaptptpcpcpcp*c)-3')	D	DNA	11
Protein (nuclear factor kappa-B P52)	A, B	protein	285	Homo sapiens	Q00653 (AlphaFold model)

Sequence of entity 1 (C), FASTA

>1A3Q_1 DNA (5'-D(*GP*GP*GP*GP*AP*AP*TP*CP*CP*CP*C)-3') (chains C)
GGGGAATCCCC

Sequence of entity 2 (D), FASTA

>1A3Q_2 DNA (5'-D(*GP*GP*GP*GP*AP*TP*TP*CP*CP*CP*C)-3') (chains D)
GGGGATTCCCC

Sequence of entity 3 (A, B), FASTA

>1A3Q_3 PROTEIN (NUCLEAR FACTOR KAPPA-B P52) (chains A, B)
GPYLVIVEQPKQRGFRFRYGCEGPSHGGLPGASSEKGRKTYPTVKICNYEGPAKIEVDLV
THSDPPRAHAHSLVGKQCSELGICAVSVGPKDMTAQFNNLGVLHVTKKNMMGTMIQKLQR
QRLRSRPQGLTEAEQRELEQEAKELKKVMDLSIVRLRFSAFLRSLPLKPVISQPIHDSKS
PGASNLKISRMDKTAGSVRGGDEVYLLCDKVQKDDIEVRFYEDDENGWQAFGDFSPTDVH
KQYAIVFRTPPYHKMKIERPVTVFLQLKRKRGGDVSDSKQFTYYP

Primary citation

Structure of the human NF-kappaB p52 homodimer-DNA complex at 2.1 A resolution. Cramer, P., Larson, C.J., Verdine, G.L. et al. EMBO J (1997) 16:7078-7090. DOI 10.1093/emboj/16.23.7078 · PubMed

Other PDB entries of the same protein (UniProt Q00653 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8G8S 2.1 Å, bipartite p52 NLS in complex with Importin alpha 2
8G8Q 2.6 Å, Monopartite p52 NLS in complex with Importin alpha 2
5ZMC 2.99 Å, Structural Basis for Reactivation of -146C>T Mutant TERT Promoter by cooperative binding…
7CLI 3.0 Å, Structure of NF-kB p52 homodimer bound to P-Selectin kB DNA fragment
7W7L 3.0 Å, Structure of NF-kB p52 homodimer bound to 13-mer A/T-centric P-Selectin kB DNA fragment
3DO7 3.05 Å, X-ray structure of a NF-kB p52/RelB/DNA complex
7VUQ 3.1 Å, Structure of NF-kB p52 homodimer bound to A/T-centric P-Selectin kB DNA fragment
4OT9 3.35 Å, crystal structure of the C-terminal domain of p100/NF-kB2
7VUP 3.4 Å, Structure of NF-kB p52 homodimer bound to +1/-1 swap P-Selectin kB DNA fragment
2D96 Solution structure of the Death domain of Nuclear factor NF-kappa-B p100

Browse structure collections

About this viewer

MolViewer shows 1A3Q directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.