Structure of NF-kB p52 homodimer bound to P-Selectin kB DNA fragment. Determined by X-ray diffraction at 3.0 Å resolution. Released 21 Jul 2021.
Explore 7CLI in 3D Show helices and sheets RCSB PDB PDBe
7CLI contains 28 α-helices and 60 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 39-44 | 6 | 1 |
| α-helix | 45 | 1 | |
| β-strand | 46 | 1 | 2 |
| α-helix | 47 | 1 | |
| β-strand | 49-51 | 3 | 3 |
| α-helix | 52-53 | 2 | |
| β-strand | 54 | 1 | 4 |
| β-strand | 67 | 1 | 2 |
| β-strand | 79-83 | 5 | 1 |
| β-strand | 89-96 | 8 | 5 |
| β-strand | 104 | 1 | 5 |
| β-strand | 108-110 | 3 | 4 |
| β-strand | 120-124 | 5 | 5 |
| β-strand | 130-132 | 3 | 1 |
| β-strand | 137-139 | 3 | 4 |
| α-helix | 140-142 | 3 | |
| α-helix | 143-160 | 18 | |
| α-helix | 168-170 | 3 | |
| α-helix | 171-184 | 14 | |
| β-strand | 189-190 | 2 | 3 |
| β-strand | 191-198 | 8 | 5 |
| β-strand | 207-208 | 2 | 5 |
| α-helix | 209-211 | 3 | |
| β-strand | 212-213 | 2 | 5 |
| α-helix | 214-216 | 3 | |
| β-strand | 217-219 | 3 | 3 |
| α-helix | 227-228 | 2 | |
| β-strand | 230-233 | 4 | 6 |
| β-strand | 237-239 | 3 | 7 |
| β-strand | 245-250 | 6 | 6 |
| β-strand | 260-263 | 4 | 8 |
| β-strand | 271-273 | 3 | 8 |
| β-strand | 275 | 1 | 6 |
| α-helix | 278-280 | 3 | |
| β-strand | 281 | 1 | 6 |
| β-strand | 286-290 | 5 | 6 |
| α-helix | 291-294 | 4 | |
| β-strand | 305-309 | 5 | 8 |
| β-strand | 310 | 1 | 9 |
| α-helix | 316 | 1 | |
| β-strand | 317 | 1 | 9 |
| α-helix | 318-320 | 3 | |
| β-strand | 321-323 | 3 | 8 |
| β-strand | 324-326 | 3 | 7 |
| α-helix | 327-328 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 39-44 | 6 | 10 |
| α-helix | 45 | 1 | |
| β-strand | 46 | 1 | 11 |
| α-helix | 47 | 1 | |
| α-helix | 51-53 | 3 | |
| β-strand | 54 | 1 | 12 |
| β-strand | 67 | 1 | 11 |
| β-strand | 79-83 | 5 | 10 |
| β-strand | 89-96 | 8 | 13 |
| β-strand | 104 | 1 | 13 |
| β-strand | 108-110 | 3 | 12 |
| β-strand | 114 | 1 | 13 |
| β-strand | 120-124 | 5 | 13 |
| β-strand | 130-132 | 3 | 10 |
| β-strand | 137-139 | 3 | 12 |
| α-helix | 140-142 | 3 | |
| α-helix | 146-155 | 10 | |
| α-helix | 168-179 | 12 | |
| β-strand | 189-190 | 2 | 14 |
| β-strand | 191-198 | 8 | 13 |
| β-strand | 207-208 | 2 | 13 |
| α-helix | 209-211 | 3 | |
| β-strand | 212-213 | 2 | 13 |
| α-helix | 214-216 | 3 | |
| β-strand | 217-218 | 2 | 14 |
| α-helix | 226-228 | 3 | |
| β-strand | 230-233 | 4 | 15 |
| β-strand | 239 | 1 | 16 |
| β-strand | 245-250 | 6 | 15 |
| β-strand | 260-264 | 5 | 17 |
| β-strand | 270-273 | 4 | 17 |
| β-strand | 275 | 1 | 15 |
| α-helix | 278-280 | 3 | |
| β-strand | 281-282 | 2 | 15 |
| β-strand | 286-290 | 5 | 15 |
| α-helix | 291-294 | 4 | |
| α-helix | 302 | 1 | |
| β-strand | 303-309 | 7 | 17 |
| β-strand | 310 | 1 | 18 |
| β-strand | 317 | 1 | 18 |
| β-strand | 321-325 | 5 | 17 |
| β-strand | 326 | 1 | 16 |
| α-helix | 327-328 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Nuclear factor NF-kappa-B p52 subunit | A, B | protein | 398 | Homo sapiens | Q00653 (AlphaFold model) |
| DNA (5'-d(*cp*ap*ap*gp*gp*gp*gp*tp*cp*ap*cp*cp*cp*cp*cp*tp*tp*c)-3') | C | DNA | 18 | Homo sapiens | |
| DNA (5'-d(*gp*ap*ap*gp*gp*gp*gp*gp*tp*gp*ap*cp*cp*cp*cp*tp*tp*g)-3') | D | DNA | 18 | Homo sapiens |
>7CLI_1 Nuclear factor NF-kappa-B p52 subunit (chains A, B) MESCYNPGLDGIIEYDDFKLNSSIVEPKEPAPETADGPYLVIVEQPKQRGFRFRYGCEGP SHGGLPGASSEKGRKTYPTVKICNYEGPAKIEVDLVTHSDPPRAHAHSLVGKQCSELGIC AVSVGPKDMTAQFNNLGVLHVTKKNMMGTMIQKLQRQRLRSRPQGLTEAEQRELEQEAKE LKKVMDLSIVRLRFSAFLRASDGSFSLPLKPVISQPIHDSKSPGASNLKISRMDKTAGSV RGGDEVYLLCDKVQKDDIEVRFYEDDENGWQAFGDFSPTDVHKQYAIVFRTPPYHKMKIE RPVTVFLQLKRKRGGDVSDSKQFTYYPLVEDKEEVQRKRRKALPTFSQPFGGGSHMGGGS GGAAGGYGGAGGGGSLGFFPSSLAYSPYQSGAGPMGCY
>7CLI_2 DNA (5'-D(*CP*AP*AP*GP*GP*GP*GP*TP*CP*AP*CP*CP*CP*CP*CP*TP*TP*C)-3') (chains C) CAAGGGGTCACCCCCTTC
>7CLI_3 DNA (5'-D(*GP*AP*AP*GP*GP*GP*GP*GP*TP*GP*AP*CP*CP*CP*CP*TP*TP*G)-3') (chains D) GAAGGGGGTGACCCCTTG
Structures of NF-kappa B p52 homodimer-DNA complexes rationalize binding mechanisms and transcription activation. Pan, W., Meshcheryakov, V.A., Li, T. et al. Elife (2023) 12. DOI 10.7554/eLife.86258 · PubMed
Other PDB entries of the same protein (UniProt Q00653 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7CLI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.