4OT9: C-terminal domain of p100/NF-kB2

crystal structure of the C-terminal domain of p100/NF-kB2. Determined by X-ray diffraction at 3.35 Å resolution. Released 14 Jan 2015.

Method: X-ray diffraction
Resolution: 3.35 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,224
Mol. weight: 38.47 kDa
Released: 14 Jan 2015

Explore 4OT9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4OT9 contains 18 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 18 helices, 0 β-strands

Element	Residues	Length
α-helix	439-467	29
α-helix	470-475	6
α-helix	478-480	3
α-helix	491-497	7
α-helix	501-512	12
α-helix	519-521	3
α-helix	530-536	7
α-helix	540-548	9
α-helix	563-567	5
α-helix	575-582	8
α-helix	586-588	3
α-helix	603-609	7
α-helix	613-621	9
α-helix	637-643	7
α-helix	647-654	8
α-helix	671-678	8
α-helix	681-689	9
α-helix	740-751	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Nuclear factor NF-kappa-B p100 subunit	A	protein	359	Homo sapiens	Q00653 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4OT9_1 Nuclear factor NF-kappa-B p100 subunit (chains A)
MAATVPSRDSGEEAAEPSAPSRTPQCEPQAPEMLQRAREYNARLFGLAQRSARALLDYGV
TADARALLAGQRHLLTAQDENGDTPLHLAIIHGQTSVIEQIVYVIHHAQDLGVVNLTNHL
HQTPLHLAVITGQTSVVSFLLRVGADPALLDRHGDSAMHLALRAGAGAPELLRALLQSGA
PAVPQLLHMPDFEGLYPVHLAVRARSPECLDLLVDSGAEVEATERQGGRTALHLATEMEE
LGLVTHLVTKLRANVNARTFAGNTPLHLAAGLGYPTLTRLLLKAGADIHAENEEPLCPLP
SPPTSDSDSDSEGPEKDTRSSFRGHTPLDLTCSTKVKTLLLNAAQNTMEPPLTPPSPAG

Primary citation

p100/I kappa B delta sequesters and inhibits NF-kappa B through kappaBsome formation. Tao, Z., Fusco, A., Huang, D.B. et al. Proc Natl Acad Sci U S A (2014) 111:15946-15951. DOI 10.1073/pnas.1408552111 · PubMed

Other PDB entries of the same protein (UniProt Q00653 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1A3Q 2.1 Å, Human nf-kappa-B P52 bound to DNA
8G8S 2.1 Å, bipartite p52 NLS in complex with Importin alpha 2
8G8Q 2.6 Å, Monopartite p52 NLS in complex with Importin alpha 2
5ZMC 2.99 Å, Structural Basis for Reactivation of -146C>T Mutant TERT Promoter by cooperative binding…
7CLI 3.0 Å, Structure of NF-kB p52 homodimer bound to P-Selectin kB DNA fragment
7W7L 3.0 Å, Structure of NF-kB p52 homodimer bound to 13-mer A/T-centric P-Selectin kB DNA fragment
3DO7 3.05 Å, X-ray structure of a NF-kB p52/RelB/DNA complex
7VUQ 3.1 Å, Structure of NF-kB p52 homodimer bound to A/T-centric P-Selectin kB DNA fragment
7VUP 3.4 Å, Structure of NF-kB p52 homodimer bound to +1/-1 swap P-Selectin kB DNA fragment
2D96 Solution structure of the Death domain of Nuclear factor NF-kappa-B p100

Browse structure collections

About this viewer

MolViewer shows 4OT9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.