1A7N: IgG1-kappa D1.3 fv

Fv fragment of mouse monoclonal antibody D1.3 (balb/c, IgG1, K) variant for chain L GLU81->asp and chain H LEU312->val. Determined by X-ray diffraction at 2.01 Å resolution. Released 29 Apr 1998.

Method: X-ray diffraction
Resolution: 2.01 Å
Organism: Mus musculus
Chains: 2
Atoms: 1,909
Mol. weight: 24.53 kDa
Released: 29 Apr 1998

Explore 1A7N in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1A7N contains 4 α-helices and 23 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain H: 2 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	203-207	5	3
β-strand	211-212	2	4
β-strand	218-225	8	3
β-strand	233-239	7	5
β-strand	246-251	6	5
β-strand	257-259	3	5
α-helix	264-266	3
β-strand	267-272	6	3
β-strand	277-282	6	3
α-helix	287-289	3
β-strand	291-298	8	5
β-strand	303-306	4	5
β-strand	310-312	3	5
β-strand	313-314	2	4

Chain L: 2 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	1
β-strand	10-13	4	2
β-strand	19-25	7	1
β-strand	33-38	6	2
β-strand	45-49	5	2
β-strand	53-54	2	2
α-helix	55	1
β-strand	62-67	6	1
β-strand	70-75	6	1
α-helix	80-82	3
β-strand	84-90	7	2
β-strand	98	1	2
β-strand	102-106	5	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
IgG1-kappa D1.3 fv (light chain)	L	protein	107	Mus musculus	P01635 (AlphaFold model)
IgG1-kappa D1.3 fv (heavy chain)	H	protein	116	Mus musculus	P01820 (AlphaFold model)

Sequence of entity 1 (L), FASTA

>1A7N_1 IGG1-KAPPA D1.3 FV (LIGHT CHAIN) (chains L)
DIVLTQSPASLSASVGETVTITCRASGNIHNYLAWYQQKQGKSPQLLVYYTTTLADGVPS
RFSGSGSGTQYSLKINSLQPDDFGSYYCQHFWSTPRTFGGGTKLEIK

Sequence of entity 2 (H), FASTA

>1A7N_2 IGG1-KAPPA D1.3 FV (HEAVY CHAIN) (chains H)
QVQLQESGPGLVAPSQSLSITCTVSGFSLTGYGVNWVRQPPGKGLEWLGMIWGDGNTDYN
SALKSRLSISKDNSKSQVFLKMNSLHTDDTARYYCARERDYRLDYWGQGTTVTVSS

Primary citation

X-Ray Structures of D1.3 Fv Mutants. Marks, C., Henrick, K., Winter, G. To be published.

Other PDB entries of the same protein (UniProt P01635 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1A2Y 1.5 Å, Hen egg white lysozyme, D18A mutant, in complex with mouse monoclonal antibody D1.3
1VFA 1.8 Å, Bound water molecules and conformational stabilization help mediate an antigen-antibody…
1VFB 1.8 Å, Bound water molecules and conformational stabilization help mediate an antigen-antibody…
1WEJ 1.8 Å, IgG1 FAB fragment (of E8 antibody) complexed with horse cytochrome C at 1.8 a resolution
1KIQ 1.85 Å, Fv mutant y(b 101)F (vh domain) of mouse monoclonal antibody D1.3 complexed with hen egg…
1DVF 1.9 Å, Idiotopic antibody D1.3 fv fragment-antiidiotopic antibody E5.2 fv fragment complex
1A7O 2.0 Å, Fv fragment of mouse monoclonal antibody D1.3 (balb/c, IgG1, K) R96L deletion mutant on…
1A7Q 2.0 Å, Fv fragment of mouse monoclonal antibody D1.3 (balb/c, IgG1, K) high affinity expressed…
1A7P 2.01 Å, Fv fragment of mouse monoclonal antibody D1.3 (balb/c, IgG1, K) engineered mutant…
1A7R 2.01 Å, Fv fragment of mouse monoclonal antibody D1.3 (balb/c, IgG1, K) variant chain L GLU81->asp
1KIP 2.1 Å, Fv mutant y(b 32)A (vh domain) of mouse monoclonal antibody D1.3 complexed with hen egg…
1QBL 2.26 Å, FAB E8 (FABE8A) X-ray structure at 2.26 Å resolution

Browse structure collections

About this viewer

MolViewer shows 1A7N directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.