Fifth egf-like domain of thrombomodulin (TMEGF5), NMR, 14 structures. Determined by solution NMR. Released 24 Dec 1997.
Explore 1ADX in 3D Show helices and sheets RCSB PDB PDBe
1ADX contains 0 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 9 | 1 | 1 |
| β-strand | 35 | 1 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Thrombomodulin | A | protein | 40 | Homo sapiens | P07204 (AlphaFold model) |
>1ADX_1 THROMBOMODULIN (chains A) QMFCNQTACPADCDPNTQASCECPEGYILDDGFICTDIDE
Structure of the fifth EGF-like domain of thrombomodulin: An EGF-like domain with a novel disulfide-bonding pattern. Sampoli Benitez, B.A., Hunter, M.J., Meininger, D.P. et al. J Mol Biol (1997) 273:913-926. DOI 10.1006/jmbi.1997.1356 · PubMed
Other PDB entries of the same protein (UniProt P07204 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1ADX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.