1AO3: A3 domain of von willebrand factor

A3 domain of von willebrand factor. Determined by X-ray diffraction at 2.2 Å resolution. Released 22 Jul 1998.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,971
Mol. weight: 39.9 kDa
Released: 22 Jul 1998

Explore 1AO3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1AO3 contains 19 α-helices and 15 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	5-12	8	1
α-helix	20-35	16
β-strand	38	1	1
β-strand	43-50	8	1
β-strand	55-58	4	1
α-helix	66-74	9
α-helix	85-97	13
α-helix	103-104	2
β-strand	108-115	8	1
α-helix	124-132	9
β-strand	135-142	8	1
α-helix	148-154	7
α-helix	156-158	3
β-strand	159	1	2
α-helix	160-162	3
β-strand	164-166	3	1
α-helix	171-177	7
α-helix	181-186	6

Chain B: 9 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	5-12	8	2
α-helix	20-35	16
β-strand	38	1	2
β-strand	43-50	8	2
β-strand	54-58	5	2
α-helix	66-75	10
α-helix	85-96	12
α-helix	99-101	3
β-strand	108-115	8	2
α-helix	124-132	9
β-strand	135-142	8	2
α-helix	148-155	8
α-helix	160-162	3
β-strand	164-166	3	2
α-helix	171-177	7
α-helix	181-186	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Von willebrand factor	A, B	protein	187	Homo sapiens	P04275 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1AO3_1 VON WILLEBRAND FACTOR (chains A, B)
CSQPLDVILLLDGSSSFPASYFDEMKSFAKAFISKANIGPRLTQVSVLQYGSITTIDVPW
NVVPEKAHLLSLVDVMQREGGPSQIGDALGFAVRYLTSEMHGARPGASKAVVILVTDVSV
DSVDAAADAARSNRVTVFPIGIGDRYDAAQLRILAGPAGDSNVVKLQRIEDLPTMVTLGN
SFLHKLC

Primary citation

The von willebrand factor A3 domain does not contain a metal ion-dependent adhesion site motif. Bienkowska, J., Cruz, M., Atiemo, A. et al. J Biol Chem (1997) 272:25162-25167. DOI 10.1074/jbc.272.40.25162 · PubMed

Other PDB entries of the same protein (UniProt P04275 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5BV8 1.59 Å, G1324S mutation in von Willebrand Factor A1 domain
7EOW 1.6 Å, High-resolution structure of vWF A1 domain in complex with caplacizumab, the first…
3ZQK 1.7 Å, Von Willebrand Factor A2 domain with calcium
1ATZ 1.8 Å, Human von willebrand factor A3 domain
1IJB 1.8 Å, The von Willebrand Factor mutant (I546V) A1 domain
2ADF 1.9 Å, Crystal Structure and Paratope Determination of 82D6A3, an Antithrombotic Antibody…
3GXB 1.9 Å, Crystal structure of VWF A2 domain
3PPV 1.9 Å, Crystal structure of an engineered VWF A2 domain (N1493C and C1670S)
3PPW 1.9 Å, Crystal structure of the D1596A mutant of an engineered VWF A2 domain (N1493C and C1670S)
3PPX 1.91 Å, Crystal structure of the N1602A mutant of an engineered VWF A2 domain (N1493C and C1670S)
1FNS 2.0 Å, Crystal structure of the von willebrand factor (VWF) A1 domain I546V mutant in complex…
3PPY 2.0 Å, Crystal structure of the D1596A/N1602A double mutant of an engineered VWF A2 domain…

Browse structure collections

About this viewer

MolViewer shows 1AO3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.