1AV1: Human apolipoprotein a-I

Crystal structure of human apolipoprotein a-I. Determined by X-ray diffraction at 4.0 Å resolution. Released 4 Feb 1998.

Method: X-ray diffraction
Resolution: 4.0 Å
Organism: Homo sapiens
Chains: 4
Atoms: 6,588
Mol. weight: 93.76 kDa
Released: 4 Feb 1998

Explore 1AV1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1AV1 contains 40 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and C: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	49-53	5
α-helix	54-58	5
α-helix	59-62	4
α-helix	66-70	5
α-helix	72-140	69
α-helix	143-144	2
α-helix	145-149	5
α-helix	150-210	61
α-helix	213-217	5
α-helix	229-242	14

Chains B and D: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	45-48	4
α-helix	49-54	6
α-helix	57-63	7
α-helix	66	1
α-helix	67-72	6
α-helix	73-117	45
α-helix	120-141	22
α-helix	144-201	58
α-helix	208-218	11
α-helix	228-239	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Apolipoprotein a-I	A, B, C, D	protein	201	Homo sapiens	P02647 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>1AV1_1 APOLIPOPROTEIN A-I (chains A, B, C, D)
MLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLD
DFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTH
LAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVL
ESFKVSFLSALEEYTKKLNTQ

Primary citation

Crystal structure of truncated human apolipoprotein A-I suggests a lipid-bound conformation. Borhani, D.W., Rogers, D.P., Engler, J.A. et al. Proc Natl Acad Sci U S A (1997) 94:12291-12296. DOI 10.1073/pnas.94.23.12291 · PubMed

Other PDB entries of the same protein (UniProt P02647 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7KJR 2.08 Å, Cryo-EM structure of SARS-CoV-2 ORF3a
9PVY 2.15 Å, Cryo-EM structure of cardiac amyloid fibril from a variant apolipoprotein A-I L90P…
3R2P 2.2 Å, 2.2 Angstrom Crystal Structure of C Terminal Truncated Human Apolipoprotein A-I Reveals…
9PVZ 2.3 Å, Cryo-EM structure of cardiac amyloid fibril from a variant apolipoprotein A-I R173P…
8VXJ 2.7 Å, The crystal structure of human apolipoprotein A-I in complex with Fab 55201
9PW3 2.73 Å, Cryo-EM structure of renal amyloid fibril from a variant apolipoprotein A-I R173P…
8EQS 3.1 Å, Structure of SARS-CoV-1 Orf3a in late endosome/lysosome-like environment, MSP1D1 nanodisc
4V6M 7.1 Å, Structure of the ribosome-SecYE complex in the membrane environment
9MXZ 9.8 Å, Lecithin:Cholesterol Acyltransferase Bound to Apolipoprotein A-I dimer in HDL
1GW3 The helix-hinge-helix structural motif in human apolipoprotein a-I determined by NMR…
1GW4 The helix-hinge-helix structural motif in human apolipoprotein a-I determined by NMR…
1ODP Peptide of human apoa-I residues 166-185. NMR, 5 structures at PH 6.6, 37 degrees…

Browse structure collections

About this viewer

MolViewer shows 1AV1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.