1AVU: Trypsin inhibitor from soybean

Trypsin inhibitor from soybean (STI). Determined by X-ray diffraction at 2.3 Å resolution. Released 28 Oct 1998.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Glycine max
Chains: 1
Atoms: 1,326
Mol. weight: 20.12 kDa
Released: 28 Oct 1998

Explore 1AVU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1AVU contains 3 α-helices and 20 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	2	1	1
β-strand	4-5	2	2
β-strand	9-10	2	2
α-helix	11	1
β-strand	12	1	3
β-strand	15-21	7	4
β-strand	29-32	4	4
β-strand	42-45	4	4
β-strand	56-59	4	4
β-strand	66	1	3
β-strand	68	1	1
β-strand	73-77	5	4
α-helix	84-86	3
β-strand	92	1	4
β-strand	94-96	3	4
β-strand	104-106	3	4
β-strand	113-114	2	4
β-strand	116-122	7	4
β-strand	131-137	7	4
β-strand	146-152	7	4
β-strand	159-164	6	4
α-helix	168-170	3
β-strand	171-175	5	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Trypsin inhibitor	A	protein	181	Glycine max	P01070 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1AVU_1 TRYPSIN INHIBITOR (chains A)
DFVLDNEGNPLENGGTYYILSDITAFGGIRAAPTGNERCPLTVVQSRNELDKGIGTIISS
PYRIRFIAEGHPLSLKFDSFAVIMLCVGIPTEWSVVEDLPEGPAVKIGENKDAMDGWFRL
ERVSDDEFNNYKLVFCPQQAEDDKCGDIGISIDHDDGTRRLVVSKNKPLVVQFQKLDKES
L

Primary citation

Kunitz-type soybean trypsin inhibitor revisited: refined structure of its complex with porcine trypsin reveals an insight into the interaction between a homologous inhibitor from Erythrina caffra and tissue-type plasminogen activator. Song, H.K., Suh, S.W. J Mol Biol (1998) 275:347-363. DOI 10.1006/jmbi.1997.1469 · PubMed

Other PDB entries of the same protein (UniProt P01070 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1AVW 1.75 Å, Complex porcine pancreatic trypsin/soybean trypsin inhibitor, orthorhombic crystal form
1AVX 1.9 Å, Complex porcine pancreatic trypsin/soybean trypsin inhibitor, tetragonal crystal form
6O1F 2.15 Å, Complex between soybean trypsin inhibitor beta1-tryptase and a humanized fab
6NTT 2.4 Å, X-ray Crystal Structure of Soybean Trypsin Inhibitor (Kunitz) Complexed with…
1BA7 2.5 Å, Soybean trypsin inhibitor

Browse structure collections

About this viewer

MolViewer shows 1AVU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.