6O1F: Tryptase alpha/beta-1

Complex between soybean trypsin inhibitor beta1-tryptase and a humanized fab. Determined by X-ray diffraction at 2.15 Å resolution. Released 16 Oct 2019.

Method: X-ray diffraction
Resolution: 2.15 Å
Organisms: Homo sapiens, Glycine max
Chains: 4
Atoms: 7,056
Mol. weight: 98.48 kDa
Released: 16 Oct 2019

Explore 6O1F in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6O1F contains 35 α-helices and 94 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	17	1	1
β-strand	20-21	2	2
α-helix	22-23	2
β-strand	30-35	6	3
β-strand	39-48	10	3
β-strand	51-54	4	3
α-helix	56-59	4
α-helix	60C-60E	3
α-helix	61-63	3
β-strand	64-68	5	3
β-strand	72	1	4
β-strand	82-83	2	3
β-strand	85-90	6	3
β-strand	95	1	5
β-strand	98	1	5
β-strand	104-108	5	3
α-helix	120-121	2
β-strand	122	1	2
α-helix	123-125	3
β-strand	136-140	5	2
β-strand	145	1	6
β-strand	149	1	6
α-helix	150-152	3
β-strand	154	1	4
β-strand	156-159	4	2
β-strand	162-163	2	2
α-helix	165-173	9
β-strand	180-183	4	2
β-strand	189	1	1
β-strand	198-203	6	2
β-strand	206-215	10	2
β-strand	221A	1	7
β-strand	224	1	7
β-strand	226-230	5	2
α-helix	231-234	4
α-helix	235-238	4

Chain H: 9 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	8
β-strand	11-12	2	9
β-strand	18-25	8	8
α-helix	29-31	3
β-strand	34-39	6	10
β-strand	45-51	7	10
β-strand	57-59	3	10
β-strand	64	1	8
β-strand	67-72	6	8
α-helix	73-75	3
β-strand	77-82	6	8
α-helix	84-86	3
β-strand	88-95	8	10
α-helix	96	1
β-strand	100B-103	4	10
β-strand	107-109	3	10
β-strand	110-111	2	9
α-helix	115-116	2
β-strand	117	1	11
β-strand	120-124	5	12
β-strand	135-145	11	12
β-strand	146	1	11
β-strand	151-154	4	13
α-helix	155-157	3
β-strand	159	1	13
β-strand	163-165	3	12
α-helix	166-168	3
β-strand	169-170	2	12
β-strand	176-185	10	12
α-helix	186-188	3
β-strand	189	1	14
β-strand	192	1	14
β-strand	194-200	7	13
α-helix	201-203	3
β-strand	205-211	7	13

Chain I: 7 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	2	1	15
β-strand	4	1	16
α-helix	9	1
β-strand	10	1	16
α-helix	11	1
β-strand	12	1	17
β-strand	15-21	7	18
β-strand	29-32	4	19
β-strand	42-45	4	19
β-strand	56-59	4	18
β-strand	62	1	2
β-strand	66	1	17
β-strand	68	1	15
β-strand	73-77	5	18
α-helix	78-79	2
α-helix	84-86	3
β-strand	92	1	18
β-strand	94-96	3	19
β-strand	104-106	3	19
α-helix	113-114	2
β-strand	116-122	7	18
β-strand	131-137	7	18
α-helix	142-144	3
β-strand	146-147	2	18
β-strand	148-152	5	19
β-strand	159-163	5	19
β-strand	168	1	19
α-helix	169	1
β-strand	170-175	6	18

Chain L: 9 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	20
β-strand	10-13	4	21
β-strand	19-30	11	20
β-strand	34-38	5	21
β-strand	45-49	5	21
β-strand	53-54	2	21
α-helix	55	1
β-strand	62-75	14	20
α-helix	80-82	3
β-strand	84-89	6	21
α-helix	96	1
β-strand	98	1	21
β-strand	102-106	5	21
β-strand	111	1	22
α-helix	112-113	2
β-strand	114-118	5	23
α-helix	119-121	3
α-helix	122-126	5
β-strand	129-139	11	23
β-strand	140	1	22
β-strand	145-150	6	24
β-strand	153-154	2	24
α-helix	155	1
β-strand	159-163	5	23
α-helix	164-167	4
β-strand	173-182	10	23
α-helix	183-186	4
β-strand	191-197	7	24
β-strand	205-210	6	24

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tryptase alpha/beta-1	A	protein	260	Homo sapiens	Q15661 (AlphaFold model)
Heavy Chain hu31A.v11	H	protein	227	Homo sapiens
Trypsin inhibitor A	I	protein	192	Glycine max	P01070 (AlphaFold model)
Light Chain hu31A.v11	L	protein	213	Homo sapiens

Sequence of entity 1 (A), FASTA

>6O1F_1 Tryptase alpha/beta-1 (chains A)
AGSTHHHHHHDDDDKIVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHC
VGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVNVSS
HVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLG
AYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPG
IYTRVTYYLDWIHHYVPKKP

Sequence of entity 2 (H), FASTA

>6O1F_2 Heavy Chain hu31A.v11 (chains H)
EVQLVESGGGLVQPGGSLRLSCAASGFTFSDYGMVWVRQAPGKGLEWVAFISSGSSTVYY
ADTMKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTRRNYDDWYFDVWGQGTLVTVSSA
STKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSG
LYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHT

Sequence of entity 3 (I), FASTA

>6O1F_3 Trypsin inhibitor A (chains I)
DFVLDNEGNPLENGGTYYILSDITAFGGIRAAPTGNERCPLTVVQSRNELDKGIGTIISS
PYRIRFIAEGHPLSLKFDSFAVIMLCVGIPTEWSVVEDLPEGPAVKIGENKDAMDGWFRL
ERVSDDEFNNYKLVFCPQQAEDDKCGDIGISIDHDDGTRRLVVSKNKPLVVQFQKLDKES
LAKKNHGLSRSE

Sequence of entity 4 (L), FASTA

>6O1F_4 Light Chain hu31A.v11 (chains L)
DIQMTQSPSSLSASVGDRVTITCSASSSVTYMYWYQQKPGKSPKPWIYRTSDLASGVPSR
FSGSGSGTDFTLTISSLQPEDFATYYCQHYHSYPLTFGQGTKVEIKRTVAAPSVFIFPPS
DEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTL
SKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Primary citation

An Allosteric Anti-tryptase Antibody for the Treatment of Mast Cell-Mediated Severe Asthma. Maun, H.R., Jackman, J.K., Choy, D.F. et al. Cell (2019) 179:417-431.e19. DOI 10.1016/j.cell.2019.09.009 · PubMed

Other PDB entries of the same protein (UniProt Q15661 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2F9N 1.6 Å, Crystal Structure of the Recombinant Human Alpha I Tryptase Mutant K192Q/D216G in…
4MPU 1.65 Å, Human beta-tryptase co-crystal structure with (6S,8R)-N,N'-bis[3-({4-[3-(aminomethyl)phen…
5F03 1.94 Å, TRYPTASE B2 IN COMPLEX WITH 5-(3-Aminomethyl-phenoxymethyl)-3-[3-(2-chloro-pyridin-3-ylet…
4MPW 1.95 Å, Human beta-tryptase co-crystal structure with [(1,1,3,3-tetramethyldisiloxane-1,3-diyl)di…
4MPX 2.0 Å, Human beta-tryptase co-crystal structure with [(1,1,3,3-tetramethyldisiloxane-1,3-diyl)di…
2ZEC 2.06 Å, Potent, Nonpeptide Inhibitors of Human Mast Cell Tryptase
2F9O 2.1 Å, Crystal Structure of the Recombinant Human Alpha I Tryptase Mutant D216G
1LTO 2.2 Å, Human alpha1-tryptase
4MQA 2.25 Å, Human beta-tryptase co-crystal structure with {(1,1,3,3-tetramethyldisiloxane-1,3-diyl)bi…
2F9P 2.3 Å, Crystal Structure of the Recombinant Human Alpha I Tryptase Mutant D216G in Complex with…
4MPV 2.31 Å, Human beta-tryptase co-crystal structure with (2R,4S)-N,N'-bis[3-({4-[3-(aminomethyl)phen…
8VGK 2.4 Å, CryoEM structure of tryptase in complex with engineered conformationally rigid…

Browse structure collections

About this viewer

MolViewer shows 6O1F directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.