1AYI: Colicin E7 immunity protein IM7

Colicin E7 immunity protein IM7. Determined by X-ray diffraction at 2.0 Å resolution. Released 28 Jan 1998.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Escherichia coli
Chains: 1
Atoms: 704
Mol. weight: 9.91 kDa
Released: 28 Jan 1998

Explore 1AYI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1AYI contains 5 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	7-9	3
α-helix	12-26	15
α-helix	32-45	14
α-helix	52-55	4
α-helix	65-78	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Colicin E immunity protein 7	A	protein	87	Escherichia coli	Q03708 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1AYI_1 COLICIN E IMMUNITY PROTEIN 7 (chains A)
MELKNSISDYTEAEFVQLLKEIEKENVAATDDVLDVLLEHFVKITEHPDGTDLIYYPSDN
RDDSPEGIVKEIKEWRAANGKPGFKQG

Primary citation

A structural comparison of the colicin immunity proteins Im7 and Im9 gives new insights into the molecular determinants of immunity-protein specificity. Dennis, C.A., Videler, H., Pauptit, R.A. et al. Biochem J (1998) 333 ( Pt 1):183-191. PubMed

Other PDB entries of the same protein (UniProt Q03708 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5WNW 1.79 Å, Chaperone Spy bound to Im7 6-45 ensemble
1CEI 1.8 Å, Structure determination of the colicin E7 immunity protein (IMME7) that binds…
1UNK 1.8 Å, Structure of colicin E7 immunity protein
2JB0 1.91 Å, Crystal structure of the mutant H573A of the nuclease domain of COLE7 in complex with IM7
1MZ8 2.0 Å, Crystal structures of the nuclease domain of COLE7/IM7 in complex with a phosphate ion…
1ZNV 2.0 Å, How a His-metal finger endonuclease ColE7 binds and cleaves DNA with a transition metal…
2ERH 2.0 Å, Crystal Structure of the E7_G/Im7_G complex; a designed interface between the colicin E7…
2JAZ 2.03 Å, Crystal structure of the mutant N560D of the nuclease domain of COLE7 in complex with IM7
1UJZ 2.1 Å, Crystal structure of the E7_C/Im7_C complex; a computationally designed interface…
2JBG 2.2 Å, crystal structure of the mutant N560A of the nuclease domain of ColE7 in complex with Im7
7CEI 2.3 Å, The endonuclease domain of colicin E7 in complex with its inhibitor IM7 protein
4F37 2.57 Å, Structure of the tethered N-terminus of Alzheimer's disease A peptide

Browse structure collections

About this viewer

MolViewer shows 1AYI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.