Complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase. Determined by X-ray diffraction at 2.3 Å resolution. Released 25 Feb 1998.
Explore 1AZS in 3D Show helices and sheets RCSB PDB PDBe
1AZS contains 33 α-helices and 24 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 380-382 | 3 | |
| β-strand | 383-398 | 16 | 1 |
| α-helix | 400-406 | 7 | |
| α-helix | 409-430 | 22 | |
| β-strand | 432-438 | 7 | 1 |
| β-strand | 441-446 | 6 | 1 |
| α-helix | 455-477 | 23 | |
| β-strand | 482-496 | 15 | 1 |
| β-strand | 505-507 | 3 | 1 |
| α-helix | 509-519 | 11 | |
| β-strand | 526-528 | 3 | 1 |
| β-strand | 542-544 | 3 | 1 |
| α-helix | 547-549 | 3 | |
| α-helix | 552-556 | 5 | |
| β-strand | 562-564 | 3 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 881-891 | 11 | 2 |
| α-helix | 895-898 | 4 | |
| α-helix | 909-923 | 15 | |
| α-helix | 924-927 | 4 | |
| α-helix | 929-931 | 3 | |
| β-strand | 934-940 | 7 | 2 |
| β-strand | 943-948 | 6 | 2 |
| α-helix | 967-990 | 24 | |
| β-strand | 997-1010 | 14 | 2 |
| β-strand | 1016-1020 | 5 | 2 |
| α-helix | 1022-1032 | 11 | |
| β-strand | 1038-1042 | 5 | 2 |
| α-helix | 1043-1051 | 9 | |
| β-strand | 1056-1064 | 9 | 2 |
| β-strand | 1068-1075 | 8 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 40-47 | 8 | 3 |
| α-helix | 53-64 | 12 | |
| α-helix | 90-112 | 23 | |
| α-helix | 122-124 | 3 | |
| α-helix | 125-133 | 9 | |
| α-helix | 144-155 | 12 | |
| α-helix | 157-163 | 7 | |
| α-helix | 166-168 | 3 | |
| α-helix | 175-179 | 5 | |
| α-helix | 182-185 | 4 | |
| α-helix | 194-199 | 6 | |
| β-strand | 207-214 | 8 | 3 |
| β-strand | 217-224 | 8 | 3 |
| α-helix | 228-237 | 10 | |
| β-strand | 243-249 | 7 | 3 |
| α-helix | 252-254 | 3 | |
| β-strand | 256 | 1 | 4 |
| β-strand | 264 | 1 | 4 |
| α-helix | 265-277 | 13 | |
| β-strand | 287-292 | 6 | 3 |
| α-helix | 294-303 | 10 | |
| α-helix | 308-310 | 3 | |
| α-helix | 313-316 | 4 | |
| α-helix | 326-327 | 2 | |
| α-helix | 332-350 | 19 | |
| β-strand | 359-363 | 5 | 3 |
| α-helix | 369-392 | 24 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| VC1 | A | protein | 220 | Canis lupus familiaris | P30803 (AlphaFold model) |
| IIC2 | B | protein | 212 | Rattus norvegicus | P26769 (AlphaFold model) |
| Gs-alpha | C | protein | 402 | Bos taurus | P04896 (AlphaFold model) |
>1AZS_1 VC1 (chains A) MHHHHHHAMEMKADINAKQEDMMFHKIYIQKHDNVSILFADIEGFTSLASQCTAQELVMT LNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCCVEMGMDMIEAISLVRE MTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGGKAGRIHITKATLSY LNGDYEVEPGCGGERNAYLKEHSIETFLILRCTQKRKEEK
>1AZS_2 IIC2 (chains B) RSLKNEELYHQSYDCVCVMFASIPDFKEFYTESDVNKEGLECLRLLNEIIADFDDLLSKP KFSGVEKIKTIGSTYMAATGLSAIPSQEHAQEPERQYMHIGTMVEFAYALVGKLDAINKH SFNDFKLRVGINHGPVIAGVIGAQKPQYDIWGNTVNVASRMDSTGVLDKIQVTEETSLIL QTLGYTCTCRGIINVKGKGDLKTYFVNTEMSR
>1AZS_3 GS-ALPHA (chains C) MGCLGNSKTEDQRNEEKAQREANKKIEKQLQKDKQVYRATHRLLLLGAGESGKSTIVKQM RILHVNGFNGEGGEEDPQAARSNSDGEKATKVQDIKNNLKEAIETIVAAMSNLVPPVELA NPENQFRVDYILSVMNVPDFDFPPEFYEHAKALWEDEGVRACYERSNEYQLIDCAQYFLD KIDVIKQDDYVPSDQDLLRCRVLTSGIFETKFQVDKVNFHMFDVGGQRDERRKWIQCFND VTAIIFVVASSSYNMVIREDNQTNRLQEALNLFKSIWNNRWLRTISVILFLNKQDLLAEK VLAGKSKIEDYFPEFARYTTPEDATPEPGEDPRVTRAKYFIRDEFLRISTASGDGRHYCY PHFTCAVDTENIRRVFNDCRDIIQRMHLRQYELLGGHHHHHH
| ID | Name | Formula | Copies |
|---|---|---|---|
| FKP | Methylpiperazinoforskolin | C30 H50 N2 O7 | 1 |
| MG | Magnesium ion | Mg | 1 |
| GSP | 5'-guanosine-diphosphate-monothiophosphate | C10 H16 N5 O13 P3 S | 1 |
Crystal structure of the catalytic domains of adenylyl cyclase in a complex with Gsalpha.GTPgammaS. Tesmer, J.J., Sunahara, R.K., Gilman, A.G. et al. Science (1997) 278:1907-1916. DOI 10.1126/science.278.5345.1907 · PubMed
Other PDB entries of the same protein (UniProt P30803 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1AZS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.