1JU5: Crk

Ternary complex of an Crk SH2 domain, Crk-derived phophopeptide, and Abl SH3 domain by NMR spectroscopy. Determined by solution NMR. Released 6 Nov 2002.

Method: Solution NMR
Organisms: Homo sapiens, Mus musculus
Chains: 3
Atoms: 1,430
Mol. weight: 20.38 kDa
Released: 6 Nov 2002

Explore 1JU5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1JU5 contains 5 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	14-15	2	1
α-helix	20-27	8
α-helix	30-31	2
β-strand	34-39	6	1
β-strand	46-52	7	1
β-strand	57-63	7	1
α-helix	70-75	6
α-helix	78-79	2
β-strand	87-89	3	1
β-strand	92-94	3	1
α-helix	97-106	10
β-strand	116-117	2	1

Chain C: 0 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	66-68	3	2
β-strand	72	1	3
β-strand	79	1	4
β-strand	82	1	3
β-strand	87-88	2	2
β-strand	89-93	5	4
β-strand	99-104	6	4
β-strand	107-112	6	4
β-strand	116-118	3	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Crk	A	protein	109	Homo sapiens	P46108 (AlphaFold model)
Crk	B	protein	13	Mus musculus	Q64010 (AlphaFold model)
Abl	C	protein	61	Homo sapiens	P00519 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1JU5_1 Crk (chains A)
SWYWGRLSRQEAVALLQGQRHGVFLVRDSSTSPGDYVLSVSENSRVSHYIINSSGPRPPV
PPSPAQPPPGVSPSRLRIGDQEFDSLPALLEFYKIHYLDTTTLIEPVSR

Sequence of entity 2 (B), FASTA

>1JU5_2 Crk (chains B)
EPGPYAQPSVNTK

Sequence of entity 3 (C), FASTA

>1JU5_3 Abl (chains C)
DPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVNS
K

Primary citation

Structure of a regulatory complex involving the Abl SH3 domain, the Crk SH2 domain, and a Crk-derived phosphopeptide. Donaldson, L.W., Gish, G., Pawson, T. et al. Proc Natl Acad Sci U S A (2002) 99:14053-14058. DOI 10.1073/pnas.212518799 · PubMed

Other PDB entries of the same protein (UniProt P46108 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5UL6 1.45 Å, The molecular mechanisms by which NS1 of the 1918 Spanish influenza A virus hijack host…
6ATV 1.75 Å, The molecular mechanisms by which NS1 of the 1918 Spanish influenza A virus hijack host…
2DVJ phosphorylated Crk-II
2EYV SH2 domain of CT10-Regulated Kinase
2EYW N-terminal SH3 domain of CT10-Regulated Kinase
2EYX C-Terminal SH3 domain of CT10-Regulated Kinase
2EYY CT10-Regulated Kinase isoform I
2EYZ CT10-Regulated Kinase isoform II
2MS4 Cyclophilin a complexed with a fragment of crk-ii

Browse structure collections

About this viewer

MolViewer shows 1JU5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.