CRK-II SH2 domain. Determined by X-ray diffraction at 1.68 Å resolution. Released 9 Aug 2017.
Explore 5JN0 in 3D Show helices and sheets RCSB PDB PDBe
5JN0 contains 5 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 8-11 | 4 | |
| β-strand | 14 | 1 | 1 |
| α-helix | 20-27 | 8 | |
| α-helix | 31 | 1 | |
| β-strand | 34-39 | 6 | 1 |
| β-strand | 47-53 | 7 | 1 |
| β-strand | 56-62 | 7 | 1 |
| β-strand | 63 | 1 | 2 |
| β-strand | 70-72 | 3 | 2 |
| β-strand | 75-77 | 3 | 2 |
| α-helix | 80-89 | 10 | |
| β-strand | 99-100 | 2 | 1 |
| α-helix | 101-102 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| CRK-II SH2 domain | A | protein | 99 | Homo sapiens | Q64010 (AlphaFold model) |
>5JN0_1 CRK-II SH2 domain (chains A) DSEERSSWYWGRLSRQEAVALLQGQRHGVFLVRDSSTSPGDYVLSVSENSRVSHYIINSS GPRRLRIGDQEFDSLPALLEFYKIHYLDTTTLIEPVARS
CRK-II SH2 domain. Cho, J.-H. To be published.
Other PDB entries of the same protein (UniProt Q64010 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5JN0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.