NMR study of SSO7D mutant (F31A) minimized average structure. Determined by solution NMR. Released 5 Jan 2000.
Explore 1B4O in 3D Show helices and sheets RCSB PDB PDBe
1B4O contains 2 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 12-15 | 4 | |
| β-strand | 30-31 | 2 | 1 |
| β-strand | 34 | 1 | 2 |
| β-strand | 40 | 1 | 2 |
| β-strand | 43-44 | 2 | 1 |
| α-helix | 52-56 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Endoribonuclease P2 | A | protein | 62 | Sulfolobus solfataricus | P61991 (AlphaFold model) |
>1B4O_1 ENDORIBONUCLEASE P2 (chains A) ATVKFKYKGEEKQVDISKIKKVWRVGKMISATYDEGGGKTGRGAVSEKDAPKELLQMLEK QK
A single-point mutation in the extreme heat- and pressure-resistant sso7d protein from sulfolobus solfataricus leads to a major rearrangement of the hydrophobic core. Consonni, R., Santomo, L., Fusi, P. et al. Biochemistry (1999) 38:12709-12717. DOI 10.1021/bi9911280 · PubMed
Other PDB entries of the same protein (UniProt P61991 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1B4O directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.