Solution structure and DNA-binding properties of a thermostable protein from the archaeon sulfolobus solfataricus. Determined by solution NMR. Released 8 May 1995.
Explore 1SSO in 3D Show helices and sheets RCSB PDB PDBe
1SSO contains 1 α-helix and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-3 | 2 | 1 |
| β-strand | 14-15 | 2 | 1 |
| β-strand | 19-23 | 5 | 2 |
| β-strand | 29-34 | 6 | 2 |
| β-strand | 40-45 | 6 | 2 |
| α-helix | 55-58 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| SSO7D | A | protein | 62 | Sulfolobus solfataricus | P61991 (AlphaFold model) |
>1SSO_1 SSO7D (chains A) ATVKFKYKGEEKQVDISKIKKVWRVGKMISFTYDEGGGKTGRGAVSEKDAPKELLQMLEK QK
Solution structure and DNA-binding properties of a thermostable protein from the archaeon Sulfolobus solfataricus. Baumann, H., Knapp, S., Lundback, T. et al. Nat Struct Biol (1994) 1:808-819. DOI 10.1038/nsb1194-808 · PubMed
Other PDB entries of the same protein (UniProt P61991 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1SSO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.