NMR solution structure of sso7d mutant, K12L, 12 conformers. Determined by solution NMR. Released 29 Aug 2006.
Explore 2CVR in 3D Show helices and sheets RCSB PDB PDBe
2CVR contains 1 α-helix and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-4 | 3 | 1 |
| β-strand | 13-15 | 3 | 1 |
| β-strand | 19-23 | 5 | 2 |
| β-strand | 29-33 | 5 | 2 |
| β-strand | 43-45 | 3 | 2 |
| α-helix | 52-58 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| DNA-binding protein 7a | A | protein | 62 | Sulfolobus solfataricus | P61991 (AlphaFold model) |
>2CVR_1 DNA-binding protein 7a (chains A) ATVKFKYKGEELQVDISKIKKVWRVGKMISFTYDEGGGKTGRGAVSEKDAPKELLQMLEK QK
Structural Determinants Responsible for the Thermostability of Sso7d and its Single Point Mutants. Arosio, I., Recca, T., Consonni, R. et al. To be published.
Other PDB entries of the same protein (UniProt P61991 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2CVR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.