1B68: Apolipoprotein E4 (APOE4), 22K fragment

Apolipoprotein E4 (APOE4), 22K fragment. Determined by X-ray diffraction at 2.0 Å resolution. Released 11 Jul 2001.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,305
Mol. weight: 22.22 kDa
Released: 11 Jul 2001

Explore 1B68 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1B68 contains 5 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	25-41	17
α-helix	45-51	7
α-helix	55-78	24
α-helix	87-124	38
α-helix	131-161	31

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Apolipoprotein E	A	protein	191	Homo sapiens	P02649 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1B68_1 APOLIPOPROTEIN E (chains A)
KVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQEL
RALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVRGRLVQYRG
EVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVYQAGAREGAERGLSAIRER
LGPLVEQGRVR

Primary citation

Interaction of the N-terminal domain of apolipoprotein E4 with heparin. Dong, J., Peters-Libeu, C.A., Weisgraber, K.H. et al. Biochemistry (2001) 40:2826-2834. DOI 10.1021/bi002417n · PubMed

Other PDB entries of the same protein (UniProt P02649 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7FCR 1.4 Å, Crystal structure of the N-terminal domain of mutants of Human Apolipoprotein-E (ApoE)
8AX9 1.55 Å, Human Apolipoprotein E4 (ApoE4) N-terminal domain (space group P212121)
8AX8 1.55 Å, Human Apolipoprotein E4 (ApoE4) N-terminal domain (space group P3121)
7FCS 1.6 Å, Crystal structure of the N-terminal domain of mutants of Human Apolipoprotein-E (ApoE)
1GS9 1.7 Å, Apolipoprotein E4, 22k domain
6NCO 1.71 Å, Fragment-based Discovery of an apoE4 Stabilizer
1OR3 1.73 Å, Apolipoprotein E3 (APOE3), trigonal truncation mutant 165
8CE0 1.75 Å, N-terminal domain of human apolipoprotein E
1NFN 1.8 Å, Apolipoprotein E3 (APOE3)
6NCN 1.82 Å, Fragment-based Discovery of an apoE4 Stabilizer
1BZ4 1.85 Å, Apolipoprotein E3 (apo-E3), truncation mutant 165
9SA6 1.89 Å, Human Apolipoprotein E4 (ApoE4) N-terminal domain (space group P212121)

Browse structure collections

About this viewer

MolViewer shows 1B68 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.