1B89: Clathrin heavy chain proximal leg segment

Name: PDB 1B89: Clathrin heavy chain proximal leg segment (BOVINE)
Published: 1999-06-04
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: clathrin

Clathrin heavy chain proximal leg segment (BOVINE). Determined by X-ray diffraction at 2.6 Å resolution. Released 4 Jun 1999.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: Bos taurus
Chains: 1
Atoms: 2,588
Mol. weight: 52.68 kDa
Released: 4 Jun 1999

Explore 1B89 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1B89 contains 24 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 24 helices, 0 β-strands

Element	Residues	Length
α-helix	1183-1186	4
α-helix	1214-1220	7
α-helix	1224-1232	9
α-helix	1237-1247	11
α-helix	1250-1262	13
α-helix	1266-1271	6
α-helix	1280-1292	13
α-helix	1296-1306	11
α-helix	1314-1325	12
α-helix	1329-1339	11
α-helix	1345-1353	9
α-helix	1358-1367	10
α-helix	1371-1380	10
α-helix	1388-1397	10
α-helix	1402-1414	13
α-helix	1416-1418	3
α-helix	1419-1426	8
α-helix	1427-1429	3
α-helix	1432-1441	10
α-helix	1449-1456	8
α-helix	1461-1473	13
α-helix	1477-1486	10
α-helix	1492-1499	8
α-helix	1505-1515	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein (clathrin heavy chain)	A	protein	449	Bos taurus	P49951 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1B89_1 PROTEIN (CLATHRIN HEAVY CHAIN) (chains A)
KFDVNTSAVQVLIEHIGNLDRAYEFAERCNEPAVWSQLAKAQLQKGMVKEAIDSYIKADD
PSSYMEVVQAANTSGNWEELVKYLQMARKKARESYVETELIFALAKTNRLAELEEFINGP
NNAHIQQVGDRCYDEKMYDAAKLLYNNVSNFGRLASTLVHLGEYQAAVDGARKANSTRTW
KEVCFACVDGKEFRLAQMCGLHIVVHADELEELINYYQDRGYFEELITMLEAALGLERAH
MGMFTELAILYSKFKPQKMREHLELFWSRVNIPKVLRAAEQAHLWAELVFLYDKYEEYDN
AIITMMNHPTDAWKEGQFKDIITKVANVELYYRAIQFYLEFKPLLLNDLLMVLSPRLDHT
RAVNYFSKVKQLPLVKPYLRSVQNHNNKSVNESLNNLFITEEDYQALRTSIDAYDNFDNI
SLAQRLEKHELIEFRRIAAYLFKGNNRWK

Primary citation

Clathrin self-assembly is mediated by a tandemly repeated superhelix. Ybe, J.A., Brodsky, F.M., Hofmann, K. et al. Nature (1999) 399:371-375. DOI 10.1038/20708 · PubMed

Other PDB entries of the same protein (UniProt P49951 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5M5T 1.7 Å, Clathrin heavy chain N-terminal domain bound to a non-natural clathrin-box motif peptide…
9F8T 1.71 Å, Clathrin terminal domain complexed with C-terminus of AAK1L
5M5R 1.76 Å, Clathrin heavy chain N-terminal domain bound to beta2 adaptin clathrin box motif
5M61 1.84 Å, Clathrin heavy chain N-terminal domain bound to an extended amphiphysin clathrin-box motif
5M5S 1.88 Å, Clathrin heavy chain N-terminal domain bound to amphiphysin clathrin-box motif
5M5V 1.96 Å, Clathrin heavy chain N-terminal domain bound to a clathrin-box motif from hepatitis D…
5M5U 2.15 Å, Clathrin heavy chain N-terminal domain bound to a clathrin-box motif from hepatitis D…
3GC3 2.2 Å, Crystal Structure of Arrestin2S and Clathrin
1UTC 2.3 Å, Clathrin terminal domain complexed with TLPWDLWTT
3GD1 3.5 Å, Structure of an Arrestin/Clathrin complex reveals a novel clathrin binding domain that…
3QIL 3.92 Å, Crystal structure analysis of the clathrin trimerization domain
6WCJ 6.3 Å, Asymmetric vertex of the clathrin minicoat cage

Browse structure collections

About this viewer

MolViewer shows 1B89 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.