1B8E: Protein

High resolution crystal structure of the bovine beta-lactoglobulin (isoforms a and B) in orthorombic space group. Determined by X-ray diffraction at 1.95 Å resolution. Released 2 May 2001.

Method: X-ray diffraction
Resolution: 1.95 Å
Organism: Bos taurus
Chains: 1
Atoms: 1,301
Mol. weight: 18.3 kDa
Released: 2 May 2001

Explore 1B8E in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1B8E contains 6 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	3-5	3
α-helix	7	1
α-helix	12-15	4
β-strand	17-18	2	1
β-strand	20-26	7	2
α-helix	29-32	4
β-strand	42-48	7	1
β-strand	54-62	9	1
β-strand	65-73	9	1
β-strand	74-75	2	2
β-strand	81-84	4	2
β-strand	90-97	8	2
β-strand	102-109	8	2
β-strand	116-123	8	2
α-helix	131-139	9
α-helix	140-142	3
β-strand	147-150	4	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein (beta-lactoglobulin)	A	protein	162	Bos taurus	P02754 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1B8E_1 PROTEIN (BETA-LACTOGLOBULIN) (chains A)
LIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQK
WENGECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLACQ
CLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI

Primary citation

Crystal structures of bovine beta-lactoglobulin in the orthorhombic space group C222(1). Structural differences between genetic variants A and B and features of the Tanford transition. Oliveira, K.M., Valente-Mesquita, V.L., Botelho, M.M. et al. Eur J Biochem (2001) 268:477-483. PubMed

Other PDB entries of the same protein (UniProt P02754 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7Q19 1.55 Å, Beta-lactoglobulin mutant FAW (I56F/L39A/M107W) in complex with desipramine (FAW-DSM#3)
4GNY 1.64 Å, Bovine beta-lactoglobulin complex with dodecyl sulfate
7Q2P 1.69 Å, Beta-lactoglobulin mutant FAW (I56F/L39A/M107W) in complex with desipramine (FAW-DSM#2)
5NUK 1.7 Å, Engineered beta-lactoglobulin: variant I56F-L39A-M107F in complex with chlorpromazine…
7Q2N 1.7 Å, Beta-lactoglobulin mutant FAF (I56F/L39A/M107F) in complex with desipramine (FAF-DSM)
7KOT 1.74 Å, Energetic and structural effects of the Tanford transition on the ligand recognition of…
1BEB 1.8 Å, Bovine beta-lactoglobulin, lattice X
7BF8 1.8 Å, Mutant I56F of recombinant bovine beta-lactoglobulin in complex with tetracaine
7BF9 1.8 Å, Mutant M107L of recombinant bovine beta-lactoglobulin in complex with tetracaine
7Q17 1.8 Å, Beta-lactoglobulin mutant FAW (I56F/L39A/M107W), unliganded form
7Q2O 1.8 Å, Beta-lactoglobulin mutant FAW (I56F/L39A/M107W) in complex with desipramine (FAW-DSM#1)
7Q18 1.8 Å, Beta-lactoglobulin mutant FAF (I56F/L39A/M107F), unliganded form

Browse structure collections

About this viewer

MolViewer shows 1B8E directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.