1BFB: Basic fibroblast growth factor

Name: PDB 1BFB: Basic fibroblast growth factor complexed with heparin tetramer fragment
Published: 1996-04-03
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: growth factor

Basic fibroblast growth factor complexed with heparin tetramer fragment. Determined by X-ray diffraction at 1.9 Å resolution. Released 3 Apr 1996.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,070
Mol. weight: 17.67 kDa
Released: 3 Apr 1996

Explore 1BFB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1BFB contains 4 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	22-26	5	1
β-strand	31-35	5	1
β-strand	41-44	4	1
α-helix	50-52	3
β-strand	54-60	7	1
β-strand	63-68	6	1
β-strand	73-77	5	1
β-strand	83-86	4	1
β-strand	95-99	5	1
α-helix	101-103	3
β-strand	105-109	5	1
β-strand	116	1	1
β-strand	119	1	2
β-strand	125	1	2
α-helix	126-127	2
α-helix	128-130	3
β-strand	140-143	4	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Basic fibroblast growth factor	A	protein	147	Homo sapiens	P09038 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1BFB_1 BASIC FIBROBLAST GROWTH FACTOR (chains A)
LPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEE
RGVVSIKGVSANRYLAMKEDGRLLASKSVTDECFFFERLESNNYNTYRSRKYTSWYVALK
RTGQYKLGSKTGPGQKAILFLPMSAKS

Primary citation

Heparin structure and interactions with basic fibroblast growth factor. Faham, S., Hileman, R.E., Fromm, J.R. et al. Science (1996) 271:1116-1120. PubMed

Other PDB entries of the same protein (UniProt P09038 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8OM6 1.31 Å, Crystal structure of FGF2-STAB, a stable variant of human fibroblast growth factor 2
8HU7 1.4 Å, Crystal structure of FGF2-M1 mutant - D28E/C78L/C96I/S137P
8HUE 1.48 Å, Crystal structure of FGF2-M2 mutant - D28E/C78I/C96I/S137P
4OEE 1.5 Å, Crystal Structure Analysis of FGF2-Disaccharide (S3I2) complex
1BFG 1.6 Å, Crystal structure of basic fibroblast growth factor at 1.6 Å resolution
4FGF 1.6 Å, Refinement of the structure of human basic fibroblast growth factor at 1.6 Å resolution…
4OEG 1.6 Å, Crystal Structure Analysis of FGF2-Disaccharide (S9I2) complex
2FGF 1.77 Å, Three-dimensional structure of human basic fibroblast growth factor, A structural…
4OEF 1.8 Å, Crystal Structure Analysis of FGF2-Disaccharide (S6I2) complex
1BAS 1.9 Å, Three-dimensional structures of acidic and basic fibroblast growth factors
5X1O 1.9 Å, PI(4,5)P2 lipid binding induced a reorientation of FGF2 molecules near membrane surface…
1BFF 2.0 Å, The 154 amino acid form of human basic fibroblast growth factor

Browse structure collections

About this viewer

MolViewer shows 1BFB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.