1BHI: Cre-BP1

Structure of transactivation domain of cre-BP1/ATF-2, NMR, 20 structures. Determined by solution NMR. Released 15 Jun 1999.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 302
Mol. weight: 4.34 kDa
Released: 15 Jun 1999

Explore 1BHI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1BHI contains 1 α-helix and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 2 β-strands

Element	Residues	Length	Sheet
β-strand	7-8	2	1
β-strand	17-18	2	1
α-helix	21-32	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cre-BP1	A	protein	38	Homo sapiens	P15336 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1BHI_1 CRE-BP1 (chains A)
MSDDKPFLCTAPGCGQRFTNEDHLAVHKHKHEMTLKFG

Primary citation

Solution structure of the transactivation domain of ATF-2 comprising a zinc finger-like subdomain and a flexible subdomain. Nagadoi, A., Nakazawa, K., Uda, H. et al. J Mol Biol (1999) 287:593-607. DOI 10.1006/jmbi.1999.2620 · PubMed

Other PDB entries of the same protein (UniProt P15336 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6ZQS 1.95 Å, Crystal structure of double-phosphorylated p38alpha with ATF2(83-102)
8YPE 1.95 Å, The crystal structure of inactive p38 complexed with a ATF2 from 46 to 80
8YPF 2.0 Å, The crystal structure of inactive p38 complexed with a ATF2 from 46 to 90
9Y0R 2.2 Å, Importin alpha 2 in complex with ATF2 basic region
6ZR5 2.7 Å, Crystal structure of JNK1 in complex with ATF2(19-58)
1T2K 3.0 Å, Structure Of The DNA Binding Domains Of IRF3, ATF-2 and Jun Bound To DNA
4H36 3.0 Å, Crystal Structure of JNK3 in Complex with ATF2 Peptide

Browse structure collections

About this viewer

MolViewer shows 1BHI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.