1BK6: Karyopherin alpha (YEAST) + SV40 T antigen nls

Karyopherin alpha (YEAST) + SV40 T antigen nls. Determined by X-ray diffraction at 2.8 Å resolution. Released 13 Jan 1999.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: Saccharomyces cerevisiae
Chains: 6
Atoms: 6,500
Mol. weight: 96 kDa
Released: 13 Jan 1999

Explore 1BK6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1BK6 contains 64 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 32 helices, 0 β-strands

Element	Residues	Length
α-helix	90-96	7
α-helix	101-113	13
α-helix	123-128	6
α-helix	132-137	6
α-helix	145-158	14
α-helix	163-170	8
α-helix	174-184	11
α-helix	187-203	17
α-helix	205-213	9
α-helix	217-223	7
α-helix	229-243	15
α-helix	252-255	4
α-helix	256-258	3
α-helix	259-265	7
α-helix	271-285	15
α-helix	289-297	9
α-helix	301-306	6
α-helix	307-309	3
α-helix	313-326	14
α-helix	331-339	9
α-helix	342-349	8
α-helix	355-368	14
α-helix	373-382	10
α-helix	385-394	10
α-helix	397-412	16
α-helix	418-426	9
α-helix	430-436	7
α-helix	442-465	24
α-helix	472-479	8
α-helix	482-488	7
α-helix	489-491	3
α-helix	495-508	14

Chain B: 32 helices, 0 β-strands

Element	Residues	Length
α-helix	90-96	7
α-helix	101-113	13
α-helix	123-128	6
α-helix	132-137	6
α-helix	145-158	14
α-helix	163-171	9
α-helix	174-184	11
α-helix	187-203	17
α-helix	205-213	9
α-helix	217-223	7
α-helix	229-243	15
α-helix	252-255	4
α-helix	256-258	3
α-helix	259-265	7
α-helix	271-285	15
α-helix	289-297	9
α-helix	301-306	6
α-helix	307-309	3
α-helix	313-326	14
α-helix	331-339	9
α-helix	342-349	8
α-helix	355-368	14
α-helix	373-381	9
α-helix	385-394	10
α-helix	397-412	16
α-helix	418-426	9
α-helix	430-436	7
α-helix	442-465	24
α-helix	472-479	8
α-helix	482-488	7
α-helix	489-491	3
α-helix	495-508	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Karyopherin alpha	A, B	protein	422	Saccharomyces cerevisiae	Q02821 (AlphaFold model)
Large T antigen	C, E	protein	6
Large T antigen	D, F	protein	5

Sequence of entity 1 (A, B), FASTA

>1BK6_1 KARYOPHERIN ALPHA (chains A, B)
LPQMTQQLNSDDMQEQLSATVKFRQILSREHRPPIDVVIQAGVVPRLVEFMRENQPEMLQ
LEAAWALTNIASGTSAQTKVVVDADAVPLFIQLLYTGSVEVKEQAIWALGNVAGDSTDYR
DYVLQCNAMEPILGLFNSNKPSLIRTATWTLSNLCRGKKPQPDWSVVSQALPTLAKLIYS
MDTETLVDACWAISYLSDGPQEAIQAVIDVRIPKRLVELLSHESTLVQTPALRAVGNIVT
GNDLQTQVVINAGVLPALRLLLSSPKENIKKEACWTISNITAGNTEQIQAVIDANLIPPL
VKLLEVAEYKTKKEACWAISNASSGGLQRPDIIRYLVSQGCIKPLCDLLEIADNRIIEVT
LDALENIIKMGEADKEARGLNINENADFIEKAGGMEKIFNCQQNENDKIYEKAYKIIETY
FG

Sequence of entity 2 (C, E), FASTA

>1BK6_2 LARGE T ANTIGEN (chains C, E)
KKKRKV

Sequence of entity 3 (D, F), FASTA

>1BK6_3 LARGE T ANTIGEN (chains D, F)
AKKAA

Primary citation

Crystallographic analysis of the recognition of a nuclear localization signal by the nuclear import factor karyopherin alpha. Conti, E., Uy, M., Leighton, L. et al. Cell (1998) 94:193-204. DOI 10.1016/S0092-8674(00)81419-1 · PubMed

Other PDB entries of the same protein (UniProt Q02821 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1WA5 2.0 Å, Structure of the Cse1:Imp-alpha:RanGTP complex
1EE4 2.1 Å, Crystal structure of yeast karyopherin (importin) alpha in a complex with a C-myc nls…
1BK5 2.2 Å, Karyopherin alpha from saccharomyces cerevisiae
5H2X 2.2 Å, Crystal structure of the karyopherin Kap60p bound to the SUMO protease Ulp1p (150-172)
4XZR 2.25 Å, Structure of yeast importin a bound to the membrane protein Nuclear Localization Signal…
1EE5 2.4 Å, Yeast karyopherin (importin) alpha in a complex with a nucleoplasmin nls peptide
4PVZ 2.5 Å, Structure of yeast importin a bound to the membrane protein Nuclear Localization Signal…
5H2W 2.5 Å, Crystal structure of the karyopherin Kap60p bound to the SUMO protease Ulp1p (150-340)
1UN0 2.6 Å, Crystal Structure of Yeast Karyopherin (Importin) alpha in complex with a Nup2p…
2C1T 2.6 Å, Structure of the Kap60p:Nup2 complex
5T94 2.63 Å, Crystal structure of Kap60 bound to yeast RCC1 (Prp20)

Browse structure collections

About this viewer

MolViewer shows 1BK6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.