FK506 binding protein fkbp mutant R42K/H87V complex with immunosuppressant FK506. Determined by X-ray diffraction at 1.6 Å resolution. Released 1 Aug 1996.
Explore 1BKF in 3D Show helices and sheets RCSB PDB PDBe
1BKF contains 4 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-8 | 7 | 1 |
| α-helix | 20 | 1 | |
| β-strand | 21-30 | 10 | 1 |
| β-strand | 35-38 | 4 | 1 |
| α-helix | 40-42 | 3 | |
| β-strand | 46-49 | 4 | 1 |
| α-helix | 57-63 | 7 | |
| β-strand | 71-76 | 6 | 1 |
| α-helix | 78-80 | 3 | |
| β-strand | 87 | 1 | 2 |
| β-strand | 91 | 1 | 2 |
| β-strand | 97-106 | 10 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| FK506 binding protein | A | protein | 107 | Homo sapiens | P62942 (AlphaFold model) |
>1BKF_1 FK506 BINDING PROTEIN (chains A) GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDKNKPFKFMLGKQEVIRGWE EGVAQMSVGQRAKLTISPDYAYGATGVPGIIPPHATLVFDVELLKLE
| ID | Name | Formula | Copies |
|---|---|---|---|
| FK5 | 8-deethyl-8-[but-3-enyl]-ascomycin | C44 H69 N O12 | 1 |
Conformation of Fk506 in X-Ray Structures of its Complexes with Human Recombinant Fkbp12 Mutants. Itoh, S., Decenzo, M.T., Livingston, D.J. et al. Bioorg Med Chem Lett (1995) 5:1983. PubMed
Other PDB entries of the same protein (UniProt P62942 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1BKF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.