1BNZ: SSO7D hyperthermophile protein/dna complex

SSO7D hyperthermophile protein/dna complex. Determined by X-ray diffraction at 2.0 Å resolution. Released 11 Nov 1998.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Sulfolobus acidocaldarius
Chains: 3
Atoms: 931
Mol. weight: 12.15 kDa
Released: 11 Nov 1998

Explore 1BNZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1BNZ contains 3 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	3-8	6	1
β-strand	11-16	6	1
α-helix	17-19	3
β-strand	20-26	7	2
β-strand	29-35	7	2
β-strand	41-47	7	2
α-helix	48-50	3
α-helix	53-62	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
5'-d(gptpapaptptpapc)-3'	B, C	DNA	8
DNA-binding protein 7A	A	protein	64	Sulfolobus acidocaldarius	P39476 (AlphaFold model)

Sequence of entity 1 (B, C), FASTA

>1BNZ_1 5'-D(*GP*TP*AP*AP*TP*TP*AP*C)-3' (chains B, C)
GTAATTAC

Sequence of entity 2 (A), FASTA

>1BNZ_2 DNA-BINDING PROTEIN 7A (chains A)
MATVKFKYKGEEKEVDISKIKKVWRVGKMISFTYDEGGGKTGRGAVSEKDAPKELLQMLE
KQKK

Primary citation

The crystal structure of the hyperthermophile chromosomal protein Sso7d bound to DNA. Gao, Y.G., Su, S.Y., Robinson, H. et al. Nat Struct Biol (1998) 5:782-786. DOI 10.1038/1822 · PubMed

Other PDB entries of the same protein (UniProt P39476 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1C8C 1.45 Å, Crystal structures of the chromosomal proteins SSO7D/SAC7D bound to DNA containing T-G…
5B02 2.21 Å, Structure of the prenyltransferase MoeN5 with a fusion protein tag of Sso7d
6J8V 2.23 Å, Structure of MOEN5-SSO7D fusion protein in complex with ligand 2
5B0I 2.26 Å, Structure of MoeN5-Sso7d fusion protein in complex with beta-octyl glucoside
5GWW 2.3 Å, Structure of MoeN5-Sso7d fusion protein in complex with a permethylated substrate analogue
6J8W 2.35 Å, Structure of MOEN5-SSO7D fusion protein in complex with lig 1
5GWV 2.4 Å, Structure of MoeN5-Sso7d fusion protein in complex with a substrate analogue
5B0J 2.5 Å, Structure of MoeN5-Sso7d fusion protein in complex with beta-undecyl maltoside
5B03 2.6 Å, Structure of MoeN5-Sso7d fusion protein in complex with geranyl pyrophosphate
5B0K 2.75 Å, Structure of MoeN5-Sso7d fusion protein in complex with beta-decyl maltoside
5B0L 2.8 Å, Structure of MoeN5-Sso7d fusion protein in complex with beta-nonyl glucoside
6PUY 2.8 Å, Structure of HIV cleaved synaptic complex (CSC) intasome bound with magnesium and INSTI…

Browse structure collections

About this viewer

MolViewer shows 1BNZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.