1C8C: Chromosomal proteins SSO7D/SAC7D

Crystal structures of the chromosomal proteins SSO7D/SAC7D bound to DNA containing T-G mismatched base pairs. Determined by X-ray diffraction at 1.45 Å resolution. Released 4 May 2001.

Method: X-ray diffraction
Resolution: 1.45 Å
Organism: Sulfolobus solfataricus
Chains: 3
Atoms: 987
Mol. weight: 12.12 kDa
Released: 4 May 2001

Explore 1C8C in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1C8C contains 3 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	1
β-strand	12-16	5	1
α-helix	17-19	3
β-strand	20-26	7	2
β-strand	29-35	7	2
α-helix	37-39	3
β-strand	41-47	7	2
α-helix	53-60	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
5'-d(gptpgpaptpcpgpc)-3'	B, C	DNA	8
DNA-binding protein 7A	A	protein	64	Sulfolobus solfataricus	P39476 (AlphaFold model)

Sequence of entity 1 (B, C), FASTA

>1C8C_1 5'-D(*GP*TP*GP*AP*TP*CP*GP*C)-3' (chains B, C)
GTGATCGC

Sequence of entity 2 (A), FASTA

>1C8C_2 DNA-BINDING PROTEIN 7A (chains A)
MATVKFKYKGEEKQVDISKIKKVWRVGKMISFTYDEGGGKTGRGAVSEKDAPKELLQMLA
KQKK

Primary citation

Crystal structures of the chromosomal proteins Sso7d/Sac7d bound to DNA containing T-G mismatched base-pairs. Su, S., Gao, Y.G., Robinson, H. et al. J Mol Biol (2000) 303:395-403. DOI 10.1006/jmbi.2000.4112 · PubMed

Other PDB entries of the same protein (UniProt P39476 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1BNZ 2.0 Å, SSO7D hyperthermophile protein/dna complex
5B02 2.21 Å, Structure of the prenyltransferase MoeN5 with a fusion protein tag of Sso7d
6J8V 2.23 Å, Structure of MOEN5-SSO7D fusion protein in complex with ligand 2
5B0I 2.26 Å, Structure of MoeN5-Sso7d fusion protein in complex with beta-octyl glucoside
5GWW 2.3 Å, Structure of MoeN5-Sso7d fusion protein in complex with a permethylated substrate analogue
6J8W 2.35 Å, Structure of MOEN5-SSO7D fusion protein in complex with lig 1
5GWV 2.4 Å, Structure of MoeN5-Sso7d fusion protein in complex with a substrate analogue
5B0J 2.5 Å, Structure of MoeN5-Sso7d fusion protein in complex with beta-undecyl maltoside
5B03 2.6 Å, Structure of MoeN5-Sso7d fusion protein in complex with geranyl pyrophosphate
5B0K 2.75 Å, Structure of MoeN5-Sso7d fusion protein in complex with beta-decyl maltoside
5B0L 2.8 Å, Structure of MoeN5-Sso7d fusion protein in complex with beta-nonyl glucoside
6PUY 2.8 Å, Structure of HIV cleaved synaptic complex (CSC) intasome bound with magnesium and INSTI…

Browse structure collections

About this viewer

MolViewer shows 1C8C directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.