1BOR: Transcription factor pml

Transcription factor pml, a proto-oncoprotein, NMR, 1 representative structure at PH 7.5, 30 C, in the presence of zinc. Determined by solution NMR. Released 1 Apr 1997.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 423
Mol. weight: 6.24 kDa
Ligands: ZN
Released: 1 Apr 1997

Explore 1BOR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1BOR contains 0 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 0 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	17	1	1
β-strand	29	1	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transcription factor pml	A	protein	56	Homo sapiens	P29590 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1BOR_1 TRANSCRIPTION FACTOR PML (chains A)
EEEFQFLRCQQCQAEAKCPKLLPCLHTLCSGCLEASGMQCPICQAPWPLGADTPAL

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Primary citation

The solution structure of the RING finger domain from the acute promyelocytic leukaemia proto-oncoprotein PML. Borden, K.L., Boddy, M.N., Lally, J. et al. EMBO J (1995) 14:1532-1541. PubMed

Other PDB entries of the same protein (UniProt P29590 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6UYR 1.3 Å, Crystal structure of K46-acetylated SUMO1 in complex with PML-SIM
6UYV 1.4 Å, Crystal structure of K46-acetylated SUMO1 in complex with phosphorylated PML-SIM
6UYP 1.42 Å, Crystal structure of K39-acetylated SUMO1 in complex with PML-SIM
4WJO 1.46 Å, Crystal Structure of SUMO1 in complex with PML
4WJN 1.5 Å, Crystal structure of SUMO1 in complex with phosphorylated PML
6UYQ 1.5 Å, Crystal structure of K45-acetylated SUMO1 in complex with PML-SIM
6UYS 1.59 Å, Crystal structure of K37-acetylated SUMO1 in complex with phosphorylated PML-SIM
5YUF 1.6 Å, Crystal Structure of PML RING tetramer
6UYO 1.64 Å, Crystal structure of K37-acetylated SUMO1 in complex with PML-SIM
6UYU 1.66 Å, Crystal structure of K45-acetylated SUMO1 in complex with phosphorylated PML-SIM
6UYT 1.66 Å, Crystal structure of K39-acetylated SUMO1 in complex with phosphorylated PML-SIM
8DJH 1.77 Å, Ternary complex of SUMO1 with a phosphomimetic SIM of PML and zinc

Browse structure collections

About this viewer

MolViewer shows 1BOR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.