1BRJ: Barnase mutant with ile 88 replaced by ala

Barnase mutant with ile 88 replaced by ala. Determined by X-ray diffraction at 2.0 Å resolution. Released 10 Jul 1995.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Bacillus amyloliquefaciens
Chains: 3
Atoms: 2,746
Mol. weight: 37.14 kDa
Ligands: ZN
Released: 10 Jul 1995

Explore 1BRJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1BRJ contains 13 α-helices and 21 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	7-17	11
β-strand	24-25	2	1
α-helix	27-32	6
α-helix	37-39	3
α-helix	42-45	4
β-strand	50-51	2	1
β-strand	52-55	4	2
α-helix	64-65	2
β-strand	71-75	5	2
β-strand	87-91	5	2
β-strand	96-99	4	2
β-strand	107-108	2	2

Chains B and C: 4 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	7-17	11
β-strand	24-25	2	3
α-helix	27-32	6
α-helix	37-39	3
α-helix	42-45	4
β-strand	50-51	2	3
β-strand	52-56	5	4
β-strand	71-75	5	4
β-strand	87-91	5	4
β-strand	96-99	4	4
β-strand	107-108	2	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Barnase	A, B, C	protein	110	Bacillus amyloliquefaciens	P00648 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>1BRJ_1 BARNASE (chains A, B, C)
AQVINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNRE
GKLPGKSGRTWREADINYTSGFRNSDRALYSSDWLIYKTTDHYQTFTKIR

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	1

Primary citation

Structural and energetic responses to cavity-creating mutations in hydrophobic cores: observation of a buried water molecule and the hydrophilic nature of such hydrophobic cavities. Buckle, A.M., Cramer, P., Fersht, A.R. Biochemistry (1996) 35:4298-4305. DOI 10.1021/bi9524676 · PubMed

Other PDB entries of the same protein (UniProt P00648 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6PQK 1.2 Å, Cryogenic crystal structure of barnase A43C/S80C bound to barstar C40A/S59C/A67C/C82A
2C4B 1.3 Å, Inhibitor cystine knot protein McoEeTI fused to the catalytically inactive barnase…
1A2P 1.5 Å, Barnase wildtype structure at 1.5 Å resolution
2ZA4 1.58 Å, Crystal Structural Analysis of Barnase-barstar Complex
1B20 1.7 Å, Deletion of a buried salt-bridge in barnase
1BRN 1.76 Å, Subsite binding in an RNase: structure of a barnase-tetranucleotide complex at 1.76 Å…
1B2X 1.8 Å, Barnase wildtype structure at PH 7.5 from a cryo_cooled crystal at 100K
1B2S 1.82 Å, Structural response to mutation at a protein-protein interface
1BRI 1.9 Å, Barnase mutant with ile 76 replaced by ala
1RNB 1.9 Å, Crystal structure of a barnase-d(*gp*c) complex at 1.9 Å resolution
1X1Y 1.9 Å, Water-mediate interaction at aprotein-protein interface
3KCH 1.94 Å, Baranase crosslinked by glutaraldehyde

Browse structure collections

About this viewer

MolViewer shows 1BRJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.