Crystal structure of the trigonal form of human plasma retinol-binding protein at 2.5 Å resolution. Determined by X-ray diffraction at 2.5 Å resolution. Released 31 Jan 1994.
Explore 1BRQ in 3D Show helices and sheets RCSB PDB PDBe
1BRQ contains 3 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 5 | 1 | 1 |
| α-helix | 6-8 | 3 | |
| α-helix | 17-20 | 4 | |
| β-strand | 22-30 | 9 | 2 |
| β-strand | 42-48 | 7 | 2 |
| β-strand | 52-62 | 11 | 2 |
| β-strand | 68-78 | 11 | 2 |
| β-strand | 85-92 | 8 | 2 |
| β-strand | 99-109 | 11 | 2 |
| β-strand | 114-123 | 10 | 2 |
| β-strand | 128 | 1 | 1 |
| β-strand | 129-138 | 10 | 2 |
| α-helix | 146-158 | 13 | |
| β-strand | 166-167 | 2 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Retinol binding protein | A | protein | 182 | Homo sapiens | P02753 (AlphaFold model) |
>1BRQ_1 RETINOL BINDING PROTEIN (chains A) ERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGR VRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSC RLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSER NL
Crystal structure of the trigonal form of human plasma retinol-binding protein at 2.5 A resolution. Zanotti, G., Ottonello, S., Berni, R. et al. J Mol Biol (1993) 230:613-624. DOI 10.1006/jmbi.1993.1173 · PubMed
Other PDB entries of the same protein (UniProt P02753 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1BRQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.