Structure of non-fluorescent human amniotic fluid RBP4. Determined by X-ray diffraction at 1.68 Å resolution. Released 7 Mar 2018.
Explore 5NU6 in 3D Show helices and sheets RCSB PDB PDBe
5NU6 contains 4 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 6-8 | 3 | |
| α-helix | 17-20 | 4 | |
| β-strand | 22-30 | 9 | 1 |
| β-strand | 39-47 | 9 | 1 |
| β-strand | 53-63 | 11 | 1 |
| β-strand | 67-79 | 13 | 1 |
| β-strand | 85-92 | 8 | 1 |
| β-strand | 100-109 | 10 | 1 |
| β-strand | 114-118 | 5 | 1 |
| β-strand | 119-123 | 5 | 2 |
| β-strand | 129-133 | 5 | 2 |
| β-strand | 134-138 | 5 | 1 |
| α-helix | 146-158 | 13 | |
| β-strand | 166-167 | 2 | 1 |
| α-helix | 168-169 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Retinol-binding protein 4 | A | protein | 182 | Homo sapiens | P02753 (AlphaFold model) |
>5NU6_1 Retinol-binding protein 4 (chains A) ERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGR VRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSC RLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSER NL
| ID | Name | Formula | Copies |
|---|---|---|---|
| PLM | Palmitic acid | C16 H32 O2 | 1 |
Water and common crystallization additives (CL) are not listed.
Human plasma retinol-binding protein (RBP4) is also a fatty acid-binding protein. Perduca, M., Nicolis, S., Mannucci, B. et al. Biochim Biophys Acta (2018) 1863:458-466. DOI 10.1016/j.bbalip.2018.01.010 · PubMed
Other PDB entries of the same protein (UniProt P02753 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5NU6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.