DBL homology domain from beta-PIX. Determined by solution NMR. Released 24 Oct 1999.
Explore 1BY1 in 3D Show helices and sheets RCSB PDB PDBe
1BY1 contains 14 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 13-35 | 23 | |
| α-helix | 36-40 | 5 | |
| α-helix | 41-43 | 3 | |
| α-helix | 53-55 | 3 | |
| α-helix | 58-62 | 5 | |
| α-helix | 63-80 | 18 | |
| α-helix | 88-120 | 33 | |
| α-helix | 124-127 | 4 | |
| α-helix | 140-144 | 5 | |
| α-helix | 151-153 | 3 | |
| α-helix | 155-157 | 3 | |
| α-helix | 158-162 | 5 | |
| α-helix | 163-164 | 2 | |
| α-helix | 174-195 | 22 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Protein (PIX) | A | protein | 209 | Homo sapiens | Q14155 (AlphaFold model) |
>1BY1_1 PROTEIN (PIX) (chains A) MKGFDTTAINKSYYNVVLQNILETENEYSKELQTVLSTYLRPLQTSEKLSSANISYLMGN LEEICSFQQMLVQSLEECTKLPEAQQRVGGCFLNLMPQMKTLYLTYCANHPSAVNVLTEH SEELGEFMETKGASSPGILVLTTGLSKPFMRLDKYPTLLKELERHMEDYHTDRQDIQKSM AAFKNLSAQCQEVRKRKELELQILTEAIR
Structure and Mutagenesis of the Dbl Homology Domain. Aghazadeh, B., Zhu, K., Kubiseski, T.J. et al. Nat Struct Biol (1998) 5:1098-1107. DOI 10.1038/4209 · PubMed
Other PDB entries of the same protein (UniProt Q14155 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1BY1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.