Apolipoprotein E3 (apo-E3), truncation mutant 165. Determined by X-ray diffraction at 1.85 Å resolution. Released 11 Nov 1998.
Explore 1BZ4 in 3D Show helices and sheets RCSB PDB PDBe
1BZ4 contains 6 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 25-42 | 18 | |
| α-helix | 45-52 | 8 | |
| α-helix | 55-78 | 24 | |
| α-helix | 82-84 | 3 | |
| α-helix | 87-124 | 38 | |
| α-helix | 131-161 | 31 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Protein (apolipoprotein E) | A | protein | 144 | Homo sapiens | P02649 (AlphaFold model) |
>1BZ4_1 PROTEIN (APOLIPOPROTEIN E) (chains A) SGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQ LTPVAEETRARLSKELQAAQARLGADMEDVCGRLVQYRGEVQAMLGQSTEELRVRLASHL RKLRKRLLRDADDLQKRLAVYQAG
Conformational flexibility in the apolipoprotein E amino-terminal domain structure determined from three new crystal forms: implications for lipid binding. Segelke, B.W., Forstner, M., Knapp, M. et al. Protein Sci (2000) 9:886-897. PubMed
Other PDB entries of the same protein (UniProt P02649 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1BZ4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.