1C5D: PDB entry 1C5D

The crystal structure of the FAB fragment of a rat monoclonal antibody against the main immunogenic region of the human muscle acetylcholine receptor. Determined by X-ray diffraction at 2.4 Å resolution. Released 3 Dec 1999.

Method: X-ray diffraction
Resolution: 2.4 Å
Organism: Rattus norvegicus
Chains: 4
Atoms: 6,715
Mol. weight: 92.83 kDa
Released: 3 Dec 1999

Explore 1C5D in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1C5D contains 18 α-helices and 89 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 21 β-strands

Element	Residues	Length	Sheet
α-helix	2-3	2
β-strand	4-6	3	13
β-strand	10-14	5	14
β-strand	18-25	8	13
β-strand	33-38	6	14
β-strand	45-49	5	14
β-strand	53-54	2	14
α-helix	55	1
β-strand	62-67	6	13
β-strand	70-76	7	13
α-helix	80-82	3
β-strand	85-90	6	14
β-strand	96-97	2	14
β-strand	101-106	6	14
β-strand	110	1	15
β-strand	113-117	5	16
α-helix	118-120	3
α-helix	121-125	5
β-strand	128-138	11	16
β-strand	139	1	15
β-strand	147-149	3	17
β-strand	152-154	3	17
β-strand	158-162	5	16
β-strand	172-181	10	16
α-helix	184-187	4
β-strand	191-192	2	17
β-strand	207-208	2	17

Chain B: 2 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	18
β-strand	11-12	2	19
β-strand	18-24	7	18
β-strand	34-39	6	20
β-strand	46-51	6	20
β-strand	57-59	3	20
β-strand	67-72	6	18
β-strand	77-82	6	18
α-helix	87-89	3
β-strand	91-97	7	20
β-strand	107	1	20
β-strand	111-113	3	20
β-strand	114-115	2	19
β-strand	121	1	21
β-strand	124-128	5	22
β-strand	140-149	10	22
β-strand	150	1	21
β-strand	155-158	4	23
β-strand	168-169	2	22
β-strand	173-175	3	22
β-strand	178-187	10	22
β-strand	196-201	6	23
α-helix	202-204	3
β-strand	206-211	6	23

Chain H: 5 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	7
β-strand	11-12	2	8
β-strand	18-24	7	7
β-strand	34-39	6	9
β-strand	46-51	6	9
β-strand	57-58	2	9
α-helix	64-66	3
β-strand	67-72	6	7
β-strand	77-82	6	7
α-helix	87-89	3
β-strand	91-97	7	9
β-strand	107	1	9
β-strand	111-113	3	9
β-strand	114-115	2	8
β-strand	121	1	10
β-strand	125-128	4	11
β-strand	140-149	10	11
β-strand	150	1	10
β-strand	155-158	4	12
α-helix	159-161	3
β-strand	169	1	11
α-helix	170-172	3
β-strand	173-175	3	11
β-strand	178-187	10	11
β-strand	196-201	6	12
α-helix	202-204	3
β-strand	206-211	6	12

Chain L: 5 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	1
β-strand	10-14	5	2
β-strand	19-25	7	1
β-strand	33-38	6	2
β-strand	45-49	5	2
β-strand	53-54	2	2
β-strand	62-67	6	1
β-strand	70-75	6	1
α-helix	80-82	3
β-strand	84-90	7	2
β-strand	96-97	2	2
β-strand	101-106	6	2
β-strand	110	1	3
β-strand	113-117	5	4
α-helix	118-120	3
α-helix	121-124	4
β-strand	128-138	11	4
β-strand	139	1	3
β-strand	144-145	2	5
β-strand	147-149	3	6
β-strand	152-154	3	6
β-strand	158-162	5	4
α-helix	163-164	2
β-strand	172-181	10	4
α-helix	182-186	5
β-strand	190-192	3	6
β-strand	195-196	2	5
β-strand	204	1	5
β-strand	207-209	3	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Monoclonal antibody against the main immunogenic region of the human muscle acetylcholine receptor	A, L	protein	213	Rattus norvegicus	P01835 (AlphaFold model)
Monoclonal antibody against the main immunogenic region of the human muscle acetylcholine receptor	B, H	protein	215	Rattus norvegicus	P20761 (AlphaFold model)

Sequence of entity 1 (A, L), FASTA

>1C5D_1 MONOCLONAL ANTIBODY AGAINST THE MAIN IMMUNOGENIC REGION OF THE HUMAN MUSCLE ACETYLCHOLINE RECEPTOR (chains A, L)
DIQMTQSPPSLSASLGDKVTITCQASQDINKYIAWYQQKPGKAPRQLIRYTSILVLGTPS
RFSGSGSGRDFSFSISNVASEDIASYYCLQYGNLYTFGAGTKLEIKRADAAPTVSIFPPS
TEQLATGGASVVCLMNNFYPRDISVKWKIDGTERRDGVLDSVTDQDSKDSTYSMSSTLSL
TKADYESHNLYTCEVVHKTSSSPVVKSFNRNEC

Sequence of entity 2 (B, H), FASTA

>1C5D_2 MONOCLONAL ANTIBODY AGAINST THE MAIN IMMUNOGENIC REGION OF THE HUMAN MUSCLE ACETYLCHOLINE RECEPTOR (chains B, H)
EVKLLESGPGLVQPSQTLSLTCTVSGFPLTTNGVSWVRQPPGKGLEWIAAISSGGSPYYN
SALKSRLSINRDTSKSQVFLKMNSLQTEDTAIYFCTREDGWNYFDYWGPGTMVTVSSAQT
TAPSVYPLAPGCGDTTSSTVTLGCLVKGYFPEPVTVTWNSGALSSDVHTFPAVLQSGLYT
LTSSVTSSTWPSQTVTCNVAHPASSTKVDKKLERR

Primary citation

The crystal structure of the Fab fragment of a rat monoclonal antibody against the main immunogenic region of the human muscle acetylcholine receptor. Kontou, M., Leonidas, D.D., Vatzaki, E.H. et al. Eur J Biochem (2000) 267:2389-2397. DOI 10.1046/j.1432-1327.2000.01252.x · PubMed

Other PDB entries of the same protein (UniProt P01835 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1LK3 1.91 Å, Engineered human interleukin-10 monomer complexed to 9D7 FAB fragment
1BFO 2.6 Å, Campath-1G IGG2B rat monoclonal FAB
1FN4 2.8 Å, Crystal structure of FAB198, an efficient protector of acetylcholine receptor against…
4UAO 3.1 Å, Crystal structure of Apical Membrane Antigen 1 from Plasmodium Knowlesi in complex with…

Browse structure collections

About this viewer

MolViewer shows 1C5D directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.