1FN4: PDB entry 1FN4

Crystal structure of FAB198, an efficient protector of acetylcholine receptor against myasthenogenic antibodies. Determined by X-ray diffraction at 2.8 Å resolution. Released 26 Sept 2001.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: Rattus norvegicus
Chains: 4
Atoms: 6,714
Mol. weight: 93.66 kDa
Released: 26 Sept 2001

Explore 1FN4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1FN4 contains 17 α-helices and 93 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	4-5	2	1
β-strand	10-12	3	2
β-strand	18-25	8	1
β-strand	33-37	5	2
β-strand	45-48	4	2
β-strand	66-67	2	1
β-strand	70-76	7	1
β-strand	85-90	6	2
β-strand	97	1	2
β-strand	102-105	4	2
β-strand	113	1	3
α-helix	119-122	4
β-strand	123	1	4
β-strand	126-131	6	4
β-strand	132	1	3
β-strand	136	1	5
β-strand	144-145	2	6
β-strand	156-159	4	4
α-helix	162-164	3
β-strand	170	1	5
β-strand	173-179	7	4
β-strand	188	1	7
β-strand	191-192	2	6
β-strand	203-204	2	6
β-strand	207	1	7

Chain B: 4 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	5-7	3	8
β-strand	11	1	9
β-strand	17-18	2	10
β-strand	21-23	3	8
β-strand	33-40	8	11
β-strand	46-51	6	11
β-strand	57-59	3	11
α-helix	61-64	4
β-strand	67	1	10
β-strand	70-72	3	8
α-helix	73-75	3
β-strand	77-79	3	8
β-strand	82-82A	2	10
β-strand	88-95	8	11
β-strand	103	1	9
β-strand	113-117	5	12
β-strand	128	1	13
β-strand	131-136	6	12
β-strand	138	1	14
α-helix	148-150	3
β-strand	156	1	12
β-strand	162-163	2	14
β-strand	168-169	2	14
β-strand	172-174	3	12
β-strand	177	1	13
β-strand	187	1	15
β-strand	192	1	16
β-strand	197	1	16
β-strand	202	1	15
α-helix	204-206	3

Chain C: 4 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	4-5	2	17
β-strand	10-12	3	18
β-strand	18-25	8	17
β-strand	33-37	5	18
β-strand	45-49	5	18
β-strand	53-54	2	18
β-strand	64-67	4	17
β-strand	70-76	7	17
β-strand	84-90	7	18
β-strand	97	1	18
β-strand	99	1	17
β-strand	102-105	4	18
β-strand	109	1	19
β-strand	112-115	4	20
α-helix	119-122	4
β-strand	123	1	20
β-strand	126-136	11	20
β-strand	137	1	19
β-strand	144-147	4	21
β-strand	156-158	3	20
α-helix	162-164	3
β-strand	170-179	10	20
α-helix	180-184	5
β-strand	188	1	22
β-strand	189-192	4	21
α-helix	201-202	2
β-strand	203-204	2	21
β-strand	207	1	22

Chain D: 7 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	23
β-strand	17-25	9	23
β-strand	33-38	6	24
β-strand	46-51	6	24
β-strand	57-59	3	24
α-helix	61-64	4
β-strand	67-72	6	23
α-helix	73-75	3
β-strand	77-82A	7	23
β-strand	90-95	6	24
β-strand	110	1	25
β-strand	113-117	5	26
β-strand	128-138	11	26
β-strand	139	1	25
α-helix	148-150	3
β-strand	157-158	2	26
α-helix	159-161	3
β-strand	162-163	2	26
β-strand	168-170	3	26
β-strand	172-177	6	26
α-helix	178-181	4
β-strand	187-189	3	27
β-strand	192	1	28
α-helix	193-195	3
β-strand	197	1	28
β-strand	200-202	3	27
α-helix	204-206	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Monoclonal antibody against acetylcholine receptor	A, C	protein	211	Rattus norvegicus	P01835 (AlphaFold model)
Monoclonal antibody against acetylcholine receptor	B, D	protein	218	Rattus norvegicus	P20760 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>1FN4_1 MONOCLONAL ANTIBODY AGAINST ACETYLCHOLINE RECEPTOR (chains A, C)
DIKLTQSPSLLSASVGDRVTLSCKGSQNINNYLAWYQQKLGEAPKLLIYNTNSLQTGIPS
RFSGSGSGTDYTLTISSLQPEDVATYFCYQYNNGYTFGAGTKLELKRTAPTVSIFPPSTE
QLATGGASVVCLMNNFYPRDISVKWKIDGTERRDGVLDSVTDQDSKDSTYSMSSTLSLTK
ADYESHNLYTCEVVHKTSSSPVVKSFNRNEC

Sequence of entity 2 (B, D), FASTA

>1FN4_2 MONOCLONAL ANTIBODY AGAINST ACETYLCHOLINE RECEPTOR (chains B, D)
QVQLLESGPGLVRPSETLSLTCTVSGFSLTSFSVSWVRHPSGKGPEWMGRMWYDGYTAYN
SALKSRLSISRDTSKNQVFLKMNSLQTDDTGTYYCTRDLYGGYPLGFWYFDFWGPGTMVT
VSSVFPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGALSSGVHTFPAVLQSGLYTL
TSSVTVPSSTWSSQAVTCNVAHPASSTKVDKKIVPRDC

Primary citation

Crystal structure of Fab198, an efficient protector of the acetylcholine receptor against myasthenogenic antibodies. Poulas, K., Eliopoulos, E., Vatzaki, E. et al. Eur J Biochem (2001) 268:3685-3693. DOI 10.1046/j.1432-1327.2001.02274.x · PubMed

Other PDB entries of the same protein (UniProt P01835 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1LK3 1.91 Å, Engineered human interleukin-10 monomer complexed to 9D7 FAB fragment
1C5D 2.4 Å, The crystal structure of the FAB fragment of a rat monoclonal antibody against the main…
1BFO 2.6 Å, Campath-1G IGG2B rat monoclonal FAB
4UAO 3.1 Å, Crystal structure of Apical Membrane Antigen 1 from Plasmodium Knowlesi in complex with…

Browse structure collections

About this viewer

MolViewer shows 1FN4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.